KEGG   Amborella trichopoda: 18442136Help
Entry
18442136          CDS       T02990                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
atr  Amborella trichopoda
Pathway
atr00620  Pyruvate metabolism
atr00710  Carbon fixation in photosynthetic organisms
atr01100  Metabolic pathways
atr01200  Carbon metabolism
Module
atr_M00168  CAM (Crassulacean acid metabolism), dark
atr_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
atr_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
atr_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    18442136
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18442136
Enzymes [BR:atr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     18442136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 18442136
NCBI-ProteinID: XP_006852422
UniProt: W1Q075
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MSKNSLVKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDVLQDLHGEDLRETVQEC
YEHSAEYEGKHDPRKLEELGSVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQTVDLVFTAHPTQSIRRS
LLQKHARIRNCLTQLYAKDITPDEKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRSTDELRVRAHELHSSSRKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERSRHLLASGTSDIPEEATYTNLEQFLEPLELCYRSLCSV
GDRPIADGSLLDFMRQVSTFGLSLVRLDIRQESDRHTDVMDAITQHLGIGSYREWSEEQR
QEWLLLELRGKRPLFGPDLPKTEEITDVLDTFHVISELPSDSFGAYIISMATSPSDVLAV
ELLQRECRVKNPLRVVPLFEKLDDLEAAPAALARLFSIDWYLNRINGKQEVMIGYSDSGK
DAGRLSAAWALYKAQVELINVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALMDEMAVVATE
EYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVLQKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
MLVSEDLWSFGEKLRVHYEETKSLLLQVAAHKDLLEGDPYLKQRLRLRDSYITTLNVCQA
YTLRRIRDPSYSVKVRPHLSKEIVDSSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
LQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaactcgttagtaaagcttgcatcaattgatgcgcagttgaggctccttgta
cctgcaaaggtctctgaggatgacaaattagttgaatatgatgctctcctcttggatcga
tttctcgacgtccttcaggatctacatggagaagatctaagggagacggttcaagagtgc
tatgagcattctgctgagtatgaggggaagcatgaccctcgaaagttggaagagctgggg
agtgtgttgactagtttggatcctggggattccattgttgttgctagctccttctcacac
atgcttaacttggccaacttggccgaagaggttcagattgcttataggaggaggatcaag
cttaagaagggagactttgctgatgagaactctgcaacaaccgaatctgacattgaggag
actctgaagaggttggtggttcagctgaagaagtcccctgaagaagtttttgatgcgctg
aagaaccagactgttgatctggtcttcacagcccaccccactcagtcgatccgaaggtca
ctgcttcagaagcatgcgaggatacggaattgtttgacccagttgtatgccaaggacatc
actcctgatgagaagcaggagcttgatgaagctctacagagagagattcaagctgcattt
cgaactgatgaaatccgccgaactcctccaactccacaagacgaaatgcgtgctgggatg
agttatttccatgaaacaatatggaaaggtgtccccaagtttttgcgtcgggttgacact
gctttgaagaatatagggattaatgaacgcgtgccatataatgcccctctcattcaattt
tcatcttggatgggaggtgaccgtgatggaaaccccagagtaactcctgaggttacaagg
gatgtgtgcttgctggcacgaatgatggctgctaatctgtacttttctcaaattgaggat
cttatgttcgagttgtccatgtggcgttccactgatgagcttcgtgttcgtgctcatgag
ctgcatagttcttcgaggaaagatgcgaagcattatatcgagttctggaaacaaattcct
cctaacgagccctaccgtgttatactcggagatgtaagggacaaactctataacactcgt
gagcgttcacgccacttgttagcaagtggaacatccgatattcctgaggaagcaacatat
accaacctggaacagttcctagaaccccttgagctctgttaccgatctttatgttcagtg
ggtgaccgacccattgcagatggaagcctcctcgacttcatgcgccaggtatccacgttt
ggcctctcccttgtgagactcgacataaggcaagagtcggatcgccacaccgatgtcatg
gatgcgatcactcagcacctcggcattgggtcataccgagaatggtccgaggaacagcgc
caagagtggcttttgttggagctgaggggaaaacgcccactattcggtcctgatctcccc
aagaccgaggagatcaccgacgtcttggacacattccatgtcatatctgagctcccatct
gatagttttggggcctacatcatctcaatggctacttcaccatcagatgtgcttgcagtt
gagctcttgcaacgagagtgtcgagtaaagaatcctttgagagttgtgcctcttttcgag
aagctagatgatctagaggctgcccctgctgcacttgcaaggctcttctcaattgattgg
tatcttaaccgaataaatgggaagcaagaggttatgattgggtattcagattcaggcaag
gatgctggtcgtctctctgctgcgtgggcgctttataaggctcaggttgagcttataaat
gtagcaaagcaatatggagtgaagcttactatgtttcatgggcgagggggcacagtggga
aggggtggtggcccaactcatcttgctatattgtctcagccacctgatacaattcatggg
tcactaagggtgacggtgcaaggagaggttatagagcagtcattcggtgaggagcatcta
tgctttaggaccttgcagaggttcaccgcggccacgcttgagcatggtatgcgccctcca
atctcaccgaagccagagtggcgagccttgatggacgagatggctgttgtggccacagaa
gagtatcggtccattgtttttaaggagcctcggtttgtcgaatatttccgacttgctact
ccggaattggagtatggacgaatgaatattgggagccgtccttcaaaaagaaaaccaagt
ggaggaatcgaatctctgcgtgctatcccctggatatttgcttggacgcaaacgaggttc
caccttcccgtgtggcttggatttggggcagcgtttaaacatgtcttgcagaaggacatc
cgaaacctgcacatgctgcaagagatgtacaatgagtggccatttttcagggtcaccatt
gacttggtggagatggttttcgccaagggagacccaggaattgctgctttgtatgataag
atgctggtatcagaagatctctggtcctttggtgagaaattgagagtgcactatgaagaa
actaagagcttgctcctgcaggttgcagcccataaggatctccttgaaggggacccctac
ttgaagcaaaggctgaggcttcgagattcgtatatcacgactctcaatgtatgccaagct
tatactctgagacggatccgagaccctagctacagtgtgaaggtgaggccacatctctct
aaggaaatcgtggactcgagcaagcctgctgctgagcttgttaagctcaaccccactagt
gagtatgctccaggccttgaggataccctcatattgaccatgaagggtattgctgccgga
cttcagaacactggttag

DBGET integrated database retrieval system