KEGG   Amborella trichopoda: 18445195Help
Entry
18445195          CDS       T02990                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] isoform X3
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
atr  Amborella trichopoda
Pathway
atr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:atr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18445195
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     18445195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 18445195
NCBI-ProteinID: XP_011627401
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKAVAVLGSKEGVSGTVFFTQEGDGPTTVTGSLSGLQPGPHGFHVHALGDTTNGCMSTG
PHFNPVGKEHGAPEDENRHAGDLGNVTVGEDGTANFTIVDSQIPLSGPNSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcggtagctgttcttggtagcaaagagggtgttagtggcacagttttcttc
actcaagaaggagatggacctactactgtaactggaagcctttctggcctgcaacctggg
ccccatggtttccatgttcatgcccttggtgacaccaccaatggctgcatgtcgactggc
ccacattttaatcctgttggcaaagaacatggtgcaccagaggatgaaaaccgccatgct
ggtgatcttggaaatgtcactgttggggaggatggtactgctaatttcaccattgttgac
agccagattccactctctgggccaaactccattattggaagggctgttgttgtccatgcc
gatcctgatgacctcggaaagggtggacatgaactcagcaaaaccactggaaatgctggt
ggcagagttgcctgtggtattattggtctccaaggctga

DBGET integrated database retrieval system