KEGG   Amborella trichopoda: 18445831Help
Entry
18445831          CDS       T02990                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
atr  Amborella trichopoda
Pathway
atr00020  Citrate cycle (TCA cycle)
atr00190  Oxidative phosphorylation
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
atr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18445831
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    18445831
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     18445831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 18445831
NCBI-ProteinID: XP_020530246
LinkDB All DBs
Position
Unknown
AA seq 631 aa AA seqDB search
MWRCVSGALRLAHAKGSISNGPIQTLLSRSLSSSSTTGSYTIVDHTYDAVVVGAGGAGLR
AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD
QDAIQYMCREAPKAVIELENYGLPFSRTDEGKIYQRAFGGQSLNFGKGGQAYRCACAADR
TGHALLHTLYGQAMKHNTQFFVEYFALDLLMDSDGSCQGVIALNMEDGTLHRFRACSTIL
ATGGYGRAYFSATSAHTCTGDGNAMVSRAGHGLEDLEFVQFHPTGIYGAGCLITEGSRGE
GGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGIGPLKDHIYLHLNHLPPD
VLKERLPGISETAAIFAGVDVTKEPIPVIPTVHYNMGGIPTNYHGEVVDIKGDDPNAVVP
GLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIYKPGEKQKPLPSDAGQKTI
AWLDKLRNSNGSLPTSKIRLNMQRVMQTHAAVFRTQETLEEGCTLIDKAWESFHDVKLHD
RSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFPMRDDENWMKHTLGYW
ENGKVGLAYRPVHMYTLDEEVEPFPPKARVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgttgcgtctctggtgcccttcgccttgctcatgcaaagggatcaatctctaat
ggacctattcaaactctactctcccgatctctttcgtcatcttctaccacgggttcttac
acaatcgtggatcacacatatgatgcggtcgtggtaggagcaggtggtgcagggcttaga
gcggccattggactttcagagcatggctttaacactgcctgtattaccaagcttttccct
acacgttctcatactgttgctgctcagggtggaattaatgcagcattggggaatatgact
gaggatgattggaggtggcatatgtatgacactgtcaaaggaagtgattggttaggtgat
caagatgctattcagtatatgtgtagagaggcgcctaaagcagtcatagagctagaaaat
tatggattgccattttcacgaaccgatgaaggaaaaatttatcaacgtgcatttggtggt
caaagcttgaattttgggaaaggtggacaggcctaccgttgtgcatgtgctgctgatcga
accggtcatgctttgcttcatacattgtatgggcaggcaatgaaacataacacacaattt
tttgtggaatactttgcattggatcttcttatggatagtgatggctcttgccagggggtg
attgcactcaacatggaggatggtactctacatcgattccgtgcttgttccacaatttta
gcgacagggggttatgggagagcttacttctctgcaacatcagctcatacatgcactggt
gatggcaatgcaatggtgtcacgagctggacatggactagaggatcttgaatttgtgcag
ttccatccaacagggatctatggtgctggttgtctcattactgaaggatcacgcggagaa
ggtggtatacttaggaatagtgaaggagaaagatttatggaaagatatgccccaactgcc
aaagatcttgcatccagggatgttgtttcaagatccatgaccatggagattcgtgaaggt
cgtggtataggacctctgaaggaccacatctatctccacttgaatcaccttccaccagat
gtacttaaggaaagacttcctggtatatcagaaactgctgctatctttgcaggagttgat
gttaccaaggagccaatccctgtgatacccactgttcattataatatgggtggcatccca
acaaattaccatggagaggtggtggatattaagggagacgaccccaatgctgtagttcct
ggacttatggcagctggtgaagcagcttgtgcatcagtgcatggtgctaacaggcttggt
gccaattcccttctggatattgttgtattcggccgagcttgtgccaatagggtcgcggag
atatataagccaggtgagaagcaaaagcctttacccagtgatgctggacagaagactatt
gcttggttagacaagctaaggaactctaatggttccttgcctacttcaaagattcgtctc
aatatgcagcgggtgatgcagacccacgctgcagtttttcgcacccaggaaacattggaa
gaggggtgtactttgattgataaagcatgggagagtttccatgatgttaagctgcatgac
aggagcctgatatggaactctgacttgatagaaactattgaactagaaaaccttttgata
aatgcatgtataacaatgcactctgccgaggctaggaaggagagcaggggtgcacatgcc
cgtgaagatttcccgatgagagatgatgaaaactggatgaagcatacattggggtactgg
gaaaatgggaaggtcgggctagcatacagacctgttcacatgtacacattggatgaagaa
gtcgaaccattccctccgaaagcacgtgtatattga

DBGET integrated database retrieval system