KEGG   Amborella trichopoda: 18446483Help
Entry
18446483          CDS       T02990                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
atr  Amborella trichopoda
Pathway
atr00630  Glyoxylate and dicarboxylate metabolism
atr00710  Carbon fixation in photosynthetic organisms
atr01100  Metabolic pathways
atr01200  Carbon metabolism
Module
atr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
atr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
atr_M00532  Photorespiration
atr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    18446483
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18446483
Enzymes [BR:atr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     18446483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 18446483
NCBI-ProteinID: XP_006856657
UniProt: U5D6Q1
LinkDB All DBs
Position
Unknown
AA seq 169 aa AA seqDB search
MAAGILPSATAFLSDAPKLTTKTALNSLSLSTNFRQKTVSNGGRTRCMKTWNPISNKKFE
TLSYLPPLSDESIAKEIDYMISKGWIPSLEFDEVGYVSRQNSRMPGYYDGRYWTLWKLPM
FGCADSSQVLREIEECKRTYPSAYIRCLAFDNQKQVQCMAFLIQKPSQA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggaatcctcccctcagcgacggcgttcctctccgacgcccccaaactcact
accaaaaccgcccttaactctctttcactctctaccaattttcgccaaaaaaccgtctcc
aacggtggaaggactcgctgcatgaagacatggaatccgatcagcaacaagaaatttgag
actctctcttacttgcccccactctctgatgaatcgattgcgaaggagatcgattacatg
atctcaaagggatggatcccttctttggaattcgatgaggtggggtacgtgtccaggcaa
aatagccggatgcctggttactacgatggaagatactggactttatggaagcttcccatg
tttgggtgtgctgactcctcacaagtgctgagagagatagaagagtgcaagaggacctat
ccaagtgcttatatacgctgccttgcttttgataaccagaaacaagtccaatgcatggcc
ttcctcatccagaaaccctctcaagcgtaa

DBGET integrated database retrieval system