KEGG   Amborella trichopoda: 18447785Help
Entry
18447785          CDS       T02990                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
atr  Amborella trichopoda
Pathway
atr00040  Pentose and glucuronate interconversions
atr00051  Fructose and mannose metabolism
atr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    18447785
   00051 Fructose and mannose metabolism
    18447785
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     18447785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N PALP Pyr_redox_3 Methyltransf_25 DUF43
Motif
Other DBs
NCBI-GeneID: 18447785
NCBI-ProteinID: XP_011628378
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MGKGAMSHGVSEEGEPENMAAWLLGVNTLKIQPFKLPPLGPHEVRVRMKAVGICGSDVHY
LKNMRCADFIVKEPMVIGHECAGIIDEVGSKVNTLVVGDRVALEPGISCWHCNYCKAGSY
NLCPDMKFFATPPVHGSLANQVVHPADLCFKLPENVSLEEGAMCEPLSVGIHACRRANAG
PETNVLVMGAGPIGLVTMLAARAFGAPKVVIVDVDDQRLSFAKAIGAHQIIKVSTDMQDV
EEDVGRIERAMEGAVDITFDCAGFGKTMSTALKATRAGGKVCLVGMGHNEMTVPLTPAAA
REVDVVGVFRYRNTWPLCLEFLSSGKIDVKPLITHRFGFSEKEVEDAFETSARGGNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggggccatgtctcatggagtttcagaagaaggggaacctgagaacatggct
gcttggcttcttggtgttaatactctcaagattcagcctttcaagctccctcctcttggt
ccacatgaagtcagagtgagaatgaaagcagtgggtatatgtgggagcgatgtgcactat
ttgaagaatatgaggtgtgctgattttattgttaaagaacctatggtcattgggcatgag
tgcgctggtataattgacgaagtagggagcaaggtgaatacactggttgttggtgaccgt
gtagctttggagcctggaatcagttgttggcactgcaactactgcaaagcgggatcctac
aatttgtgccctgatatgaagttttttgcaacacctccagtgcatggctctctggcaaat
caggttgttcatcctgctgatctgtgttttaagctgcctgaaaatgtgagcttggaagaa
ggtgcaatgtgtgagccccttagtgttggtatccatgcttgtcgtcgagcaaatgctgga
ccagagaccaatgtattggtaatgggggctggcccaataggccttgttacaatgctcgca
gcccgtgctttcggagccccaaaggttgttatagtggatgtagatgaccaacgattatct
tttgccaaagcgattggtgcacatcaaattatcaaagtttctacagatatgcaggatgtc
gaggaagacgtaggccgaatagaaagagcaatggagggtgcagttgatataacatttgat
tgtgctggctttggcaaaactatgtcgactgccctgaaggcgacacgtgctggcggtaaa
gtttgccttgtgggaatgggacacaacgagatgactgtgcccctgactcctgctgctgca
agagaagtggatgttgttggtgtctttcgataccgaaacacatggcctctttgcctcgag
ttcttgagcagtggaaagatcgatgtgaagcctttgataacgcataggtttgggttctct
gaaaaggaggttgaagacgccttcgagactagtgctcgaggtggtaatgctatcaaggtt
atgttcaatctttag

DBGET integrated database retrieval system