KEGG   Aegilops tauschii (wheat D): 109732741Help
Entry
109732741         CDS       T04345                                 

Gene name
LOC109732741
Definition
(RefSeq) beta-galactosidase 8 isoform X1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00052  Galactose metabolism
ats00511  Other glycan degradation
ats00531  Glycosaminoglycan degradation
ats00600  Sphingolipid metabolism
ats00604  Glycosphingolipid biosynthesis - ganglio series
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109732741 (LOC109732741)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    109732741 (LOC109732741)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    109732741 (LOC109732741)
   00604 Glycosphingolipid biosynthesis - ganglio series
    109732741 (LOC109732741)
   00511 Other glycan degradation
    109732741 (LOC109732741)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ats04147]
    109732741 (LOC109732741)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     109732741 (LOC109732741)
Exosome [BR:ats04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109732741 (LOC109732741)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: XP_020147513
LinkDB All DBs
Position
Unknown
AA seq 674 aa AA seqDB search
MASAGSFGRLSLLLALSLCSALASTVPGEAPRRFWIEGDAFWKDGARFQIVGGDVHYFRI
VPEYWKDRLLRAKALGLNTIQTYVPWNLHEPEPQSWEFKGFADIESYLRLAQELEMLVML
RVGPYICGEWDLGGFPPWLLTIEPALKLRSSDSTYLFLVERWWRVLLPKVAPLLYENGGP
IIMVQIENEFGSFGDDKNYLHYLVQLARRYLGNDIVLYTTDGGTTNTLKNGAILQDDVFA
AVDFSTGDDPWPIFRLQKKYNLPGKSAPLSAEFYTGWLTHWGESIATTTASSTAKALKSI
LCRNGSAVLYMAHGGTNFGFYNGANTGQTEFEYKADLTSYDYDAPIKEHGDVHNPKYKAL
RRVIHECTGTPLHPLPADIERASYGLVKLQKVASFFDIFDKICDPLKVAVSEQPLSMELT
GQMFGFLLYVSEYQGKGPYSILSIPKVHDRAQVFVSCSLDDVRNQIYAGVIERWSSKTLQ
IPTLNCSSNIRLSILVENMGRVNYGPYIFDQKGILSTVEIDGVTLHHWKMYPLSFNLLDN
LSKFQPIQQITDARASKVSSHGGSQTKLRDLSFYLNGNSEEPEFYEGHFHIDSNSTIKDT
FISFRGWNKGVAFVNNFNIGRFWPVMGPQCALYVPAPILRSGDNIVVIFELHVPNPERTI
NLVKDPDFTCGPNR
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgccggaagcttcgggaggctctctcttctcctcgcgctctcgctgtgctcc
gcgctcgcatccacggtccccggcgaggctccgaggaggttctggatcgagggcgacgcc
ttctggaaggacggggcacggttccagatcgtcggcggcgacgtgcactacttccgcatt
gtccccgagtactggaaagatcgccttttaagggctaaggcactgggcctgaacacaatt
caaacatatgttccttggaatttgcacgagccggaaccacagagctgggaattcaagggt
ttcgctgacattgaatcgtatctaagacttgctcaagaattagaaatgctcgtcatgctt
cgtgtaggtccatatatttgtggagaatgggatttagggggatttccaccatggttgctc
accatagaaccagcccttaaactgcgatcatcagactcaacctatcttttcttggtagag
agatggtggagagtcttgctcccaaaagtagcaccactgttatacgagaatggaggtcca
attatcatggtgcagattgaaaatgaatttggttcatttggagatgacaagaattacctt
cattaccttgttcagttggccagacgatatctggggaatgacattgttctgtatacaact
gatgggggcactactaataccttaaagaatggagcaattcttcaagatgatgtcttcgct
gctgttgatttttcaactggtgatgatccatggccaatattcagattacagaagaaatat
aacttaccgggaaaatcagcccctttaagtgcggaattttataccggatggctaacacac
tggggtgagagtattgccacaacaactgccagcagcacagctaaagctcttaaaagtatt
ctatgccgcaatggttctgctgtactctatatggctcatggagggacaaattttgggttt
tacaatggagcaaatactggtcaaactgaattcgagtataaggcagacctcacatcttat
gattatgatgcgccaattaaggagcatggagacgtgcataatcccaaatacaaagcattg
agaagagtaatacatgaatgcactggcacacctctgcatccacttcctgccgacattgaa
agagcaagttatgggcttgtgaaattacaaaaggttgcttctttctttgacatatttgat
aagatctgtgatccactgaaagtggctgtttcagaacagcctctgtctatggaactgaca
ggccagatgtttgggtttctactgtatgtgtcggaataccaaggaaaaggtccttacagc
atcctatcaattccaaaggtacatgacagagcccaggtgtttgtgtcatgctcacttgat
gacgtcagaaatcaaatatatgctggcgttattgaaagatggtctagtaaaaccctacag
ataccaaccttaaactgctcttctaatatccgcttatctatcctggtagaaaatatgggc
cgtgtaaattatgggccatacatttttgaccagaaggggatattatctactgttgaaata
gatggtgtgactctccatcactggaaaatgtacccgttatcgttcaatttactggacaac
ctttcgaaattccaaccaatccagcagatcactgatgccagagctagcaaagtgtccagt
catggtggttcacaaactaagctacgtgatttgtcattctatctaaatggcaattcagaa
gagccagaattttatgaaggccatttccacattgactccaatagcacgataaaggataca
ttcatatcattccgtggttggaacaaaggggttgcttttgtgaacaacttcaacatcgga
aggttctggccggtaatgggaccgcagtgcgctctttatgttcctgctccaatcctcaga
tctggagacaacattgttgtaatcttcgaactgcatgttccaaatcctgagcgtactatc
aacttggtaaaagatccagatttcacgtgcggtccaaatcgatga

DBGET integrated database retrieval system