KEGG   Aegilops tauschii (wheat D): 109732797Help
Entry
109732797         CDS       T04345                                 

Gene name
LOC109732797
Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ats01001]
    109732797 (LOC109732797)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109732797 (LOC109732797)
Protein kinases [BR:ats01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   109732797 (LOC109732797)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Pkinase_C APH FTA2 Haspin_kinase RIO1
Motif
Other DBs
NCBI-ProteinID: XP_020147580
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MVSSEIPSVTTTHTQRPKLFTGMILLPKGPPDVVLPENVEFDFNDVFGATAVQTPTEVSI
LTPGSPAPLAESNEEVYNDPVVITKRSHSLVGPTSLVSQSLPLSKLTLHESESSLDLLEC
LSKEKKSGQGSLSDEELNDTTKENEAVGLDDFELLKLVGQGAFGKVYQVRRKCTSDIYAM
KVMRKDKILEKNHAEYMKAERDILTKVDHPFVVQLRYSFQTKYRLYLVLDFVNGGHLFFQ
LYQQGLFREELARIYTAEIVSAVAHLHANGIMHRDLKPENILLDAHGHAMLTDFGLAKEF
DENTRSNSMCGTVEYMAPEIVQGRGHDKAADWWSVGILLFEMLTGKPPFFGGNRDKIQQK
IVKEKMKLPTYLSSEVHSLLKGLLHKEAGRRLGSGPGGSDEIKNHKWFKAVNWKKLEARQ
ITPSFCPNVAGQTCIANFDECWTSMPVLDSPVASPVAADSNFVGFSYVRPEPFLQKPSPL
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctgagataccttcagttacaacaacccatacacaacgccccaagctcttt
acagggatgatacttctgccaaaagggcctccagatgttgtccttcctgaaaatgttgag
tttgattttaacgatgtttttggtgctacggcggtccagacccccacagaagtaagcatt
ctcactccaggcagccctgcacctttggctgagtccaatgaggaggtttacaatgaccct
gtagtcattaccaagcgatctcattctcttgttggcccaacttcacttgttagccaatcc
ttgccacttagtaagcttactctacatgagtctgagagctcattagatctgctagagtgt
ctttctaaagaaaagaaaagtggccaggggagtcttagtgatgaagagctcaatgataca
acaaaggagaatgaggctgttggactcgacgactttgaactcttgaagcttgttggccaa
ggggcatttggcaaagtctatcaggtgagaaggaaatgtacttcagatatatatgcaatg
aaagtcatgaggaaagacaagattttggagaagaaccatgctgagtacatgaaagcagag
agagatatactgacaaaagttgatcatccttttgtggtgcagctgaggtactcctttcag
actaagtaccgactttatctggtcttggactttgtaaatggggggcatctcttctttcag
ctttaccaacaaggcttgtttagggaggagcttgcgcgcatctatactgctgaaattgta
tctgctgtagcccaccttcatgccaatgggattatgcatagagatctgaagcctgagaac
atcttattggacgctcatggccatgccatgctaactgattttggcctggcaaaggagttt
gatgagaacactagatcaaattcaatgtgcggcactgtggagtatatggccccagaaatt
gttcagggcagaggtcatgataaggctgcagactggtggagtgtggggatccttcttttt
gaaatgcttacgggcaagcccccattttttggtggaaacagggacaagattcagcagaag
atagtgaaggagaagatgaagcttccaacgtatttgtctagtgaggttcactctctgctg
aaagggttactgcacaaagaagctggcaggcggcttggaagtgggccgggcggcagtgac
gaaataaagaaccacaagtggttcaaggcagtgaactggaagaaactagaggctcgacag
atcacgccaagcttctgcccaaatgttgctgggcagacctgcattgcaaactttgacgag
tgctggacgagtatgcccgtgctggactcccccgtggccagccctgtcgctgcagatagc
aacttcgtggggttcagttacgtgcggccggagccattccttcaaaagccgagtcctcta
ggctga

DBGET integrated database retrieval system