KEGG   Aegilops tauschii (wheat D): 109734462Help
Entry
109734462         CDS       T04345                                 

Gene name
LOC109734462
Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00480  Glutathione metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109734462 (LOC109734462)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ats02000]
    109734462 (LOC109734462)
Enzymes [BR:ats01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109734462 (LOC109734462)
Transporters [BR:ats02000]
 Other Transporters
  Pores ion channels [TC:1]
   109734462 (LOC109734462)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_N_4 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: XP_020149261
LinkDB All DBs
Position
Unknown
AA seq 229 aa AA seqDB search
MAEPVKLIGTLGSPFVHRAAAALRLKGVPYELVLEDLQSKSELLLKHNPIHQKVPVLLHG
GRAICESLLIMEYVDEAFDGPPLLPTDPYARAMARFWAQFLEQKCARPFWLAMWLDAGEE
QKAYVKEMKENLALLEGQLQGKRFFGGDSIGYLDVAACGPAHWIYAFEEVTGVSLMGEND
EFPALRRWAKEYTENETVKECLPTREQLVAVFSANKDKYKMIANEMLHQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaccggttaagctcatcggcacattggggagcccattcgtccaccgggctgcc
gccgccctgcggctcaaaggggtgccctacgagctggtcctggaagatctccagagcaag
agcgagctgctgctgaagcacaaccccatccaccagaaggtgccggtgcttcttcacggc
ggccgggccatctgcgagtccctcctcatcatggagtacgtcgatgaggccttcgacggg
ccgcccctcctgccgactgatccctacgcccgtgccatggcccgtttctgggctcagttc
ctagaacagaagtgcgcgaggccgttctggctagccatgtggctggacgctggcgaggag
cagaaggcctacgtgaaggagatgaaggagaacctggcgctgctggaagggcagctccaa
gggaagaggttcttcggcggcgactccattggctacctcgacgtcgccgcctgcgggccg
gctcactggatctatgcgttcgaggaggtgacaggggtgagcttgatgggcgagaacgac
gagttccctgctctgcgccgctgggcaaaggagtataccgagaatgaaaccgtgaaggag
tgcctgccgacgagggagcagctcgtcgctgttttcagcgcgaacaaggacaaatacaag
atgatagccaacgagatgctccatcagtag

DBGET integrated database retrieval system