KEGG   Aegilops tauschii (wheat D): 109735899Help
Entry
109735899         CDS       T04345                                 

Gene name
LOC109735899
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00040  Pentose and glucuronate interconversions
ats00051  Fructose and mannose metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109735899 (LOC109735899)
   00051 Fructose and mannose metabolism
    109735899 (LOC109735899)
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109735899 (LOC109735899)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Sacchrp_dh_NADP 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: XP_020150689
LinkDB All DBs
Position
Unknown
AA seq 365 aa AA seqDB search
MGKGGKGEAAAAVAGEGENMAAWLVAKNTLKIMPFKLPPLGPYDVRVRMKAVGICGSDVH
YLKEMRIAHFVVKEPMVIGHECAGIIEEVGDGVKHLAVGDRVALEPGISCWRCRHCKGGR
YNLCDDMKFFATPPYHGSLADQIVHPGDLCFKLPDNVSLEEGAMCEPLSVGVHACRRADV
GAEKSVLIMGAGPIGLVTMLSARAFGAPRIVIADVDDHRLSVAKSLGADAVVKVSGNAED
LAGEIERIQAAMGGDIDVSLDCAGFSKTMSTALEATRPGGRVCLVGMGHNEMTVPLTSAA
IREVDVVGIFRYKDTWPLCLEFLRSGKIDVKPLITHRFGFSQGEVEEAFEVSARGRDAIK
VMFNL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggagggaaaggcgaggcggcggcggccgtggccggcgagggggagaacatg
gcggcgtggctcgtggccaagaacaccctcaagatcatgcccttcaagcttccgccgctc
ggtccttatgatgtgcgagtccggatgaaggcggtgggcatctgcggcagcgacgtgcat
tacctcaaggagatgcgcattgcgcatttcgtggtgaaagagccgatggtgatcgggcac
gagtgcgctggcatcatcgaggaggtgggcgacggcgtgaagcacctcgccgtgggagac
cgcgtggcgctggagcccggcatcagctgctggcgctgcaggcactgcaagggcggccgc
tacaacctctgcgacgacatgaagttcttcgccaccccaccttaccatggatcactcgcc
gaccagattgtgcatccaggtgacctgtgcttcaagcttccagacaacgtgagcctggag
gagggcgccatgtgcgagcccctgagcgtgggggtgcacgcctgccgccgagccgacgtg
ggcgcggagaagagcgtgctcatcatgggcgccggcccgatcggcctggtcaccatgctc
tcggcgcgcgccttcggggcgcccaggatcgtcatcgccgacgtcgacgaccaccgcctg
tccgtcgccaagtcgctcggcgcggacgccgtcgtgaaggtctccggcaacgcggaggac
ctcgcgggggagatcgagcgcatccaggcggcgatgggaggcgacatcgacgtgagcctg
gactgcgccgggttcagcaagacgatgtcgaccgcgctggaggcgacgcggccgggcggc
agggtgtgcctggtggggatggggcacaacgagatgacggtgccgctgacgtcggcggcg
atccgggaggtggacgtggtggggatcttccgttacaaggacacgtggccgctgtgcctc
gagttcctgcggagcggcaagatcgacgtgaagccgctcatcacgcacaggttcggcttc
tcgcagggggaggtggaggaggccttcgaggtcagcgcgcgcggccgcgacgccatcaag
gtcatgttcaacctttag

DBGET integrated database retrieval system