KEGG   Aegilops tauschii (wheat D): 109740282Help
Entry
109740282         CDS       T04345                                 

Gene name
LOC109740282
Definition
(RefSeq) ATP-dependent DNA helicase PIF1-like
  KO
K15255  ATP-dependent DNA helicase PIF1 [EC:3.6.4.12]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ats03032]
    109740282 (LOC109740282)
   03029 Mitochondrial biogenesis [BR:ats03029]
    109740282 (LOC109740282)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     109740282 (LOC109740282)
DNA replication proteins [BR:ats03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109740282 (LOC109740282)
Mitochondrial biogenesis [BR:ats03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    109740282 (LOC109740282)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIF1 AAA_30 Herpes_Helicase AAA_16 AAA_19 UvrD_C_2 AAA_22 PhoH DUF2791
Motif
Other DBs
NCBI-ProteinID: XP_020154906
LinkDB All DBs
Position
Unknown
AA seq 718 aa AA seqDB search
MVRGKMLDNRWVVPYNPYLLRMFNCHINVEVCSSIKAVKYLYKYIYKGHDKASFSIDHPD
ADGRIVSANPAEGDRYYLRVLLNHVTGKTSFDDLLTVDGVLCGSFREAAERLGLIEADNT
LDNCLTEAEQWAMPCSLRRLFATILVHCEPGDVRGLWDRHLDPMSDDYRRSRTSPIEVEQ
MVLLDIRGMLQSMGKDIVDFALPSIDDAFDPTEGEAREVIEESTVEFDVDDTKLASSLNL
EQRVAYDEILAAIERGDGGVFFVDGPGGTGKTFLYRAMLAKVRSDGNIGIATATSGVAAS
IMPGGRTAHSRFKIPLSCDDGASCSFTKQSGTAKLLRMASLIIWDEASMTKRQAVEALDN
SMRDIMGIRDRPFGGKTVVFGGDFRQVLPVLRRGSRGQIIDATLRSSHLWKGMRQLRLIT
NMRAHNDTWFANYLLRVGNGTEEVDDQGNILLPEDICLPSTGEVDDLEKLIHHVFLSLDD
NMYDSNYMTSRAILSMTNDNVDKINIRMIERFQGDEVIYHSFDSAEDDPYGYYAQEFPNG
LTPNGLPPHALKLKLNCPVILLRNIDPENGLCNGTRLVVRGFERNTIDAEIVIGQHAGRR
VFLPRIPLCPSENDMFPFKFKRKQFPIRLSFAMTINKDQGQTILIVGVYLPNPVFSHGQL
YVALSRATAKRNIKILIQKEKPKEKSNKQKDNPKKRKRPTMSLLTSMKNIFYKEVLTG
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggtccgagggaagatgttggacaacagatgggttgtgccttataacccatacctgctg
cggatgttcaattgccacatcaacgttgaggtctgctccagcataaaggccgtcaaatat
ctttacaagtacatttacaagggccatgataaggcttctttcagcatcgaccatcccgac
gccgatggtcgcatcgtgtctgccaatcctgccgagggtgaccgatactacctgcgtgtg
ttgctaaaccatgttacgggcaaaacatccttcgacgacttgctcaccgtggacggcgtt
ctatgtgggagctttagagaagctgctgaaaggttgggactcatcgaggcagacaacacg
ctcgacaactgtcttactgaggctgagcagtgggcgatgccatgttctcttaggaggctc
ttcgcaaccatcttggtgcactgcgagccaggcgacgtgcgtggtttatgggataggcac
ctcgatcctatgtcagatgactatcgtcgatcacgcacgtcccctatcgaggtggagcag
atggtgttgcttgacattaggggtatgttgcagtccatgggtaaagacattgttgatttc
gctcttccaagcatagatgatgcgtttgacccaaccgagggtgaggcaagagaggtcatc
gaggaatcaactgttgagtttgacgtggatgatactaaattggcatcttccctgaacttg
gagcagagggtcgcatacgacgagatactagcggctattgaacgcggtgatgggggtgta
ttctttgttgatggccctggaggtacagggaagacctttctatacagggcgatgcttgcc
aaggtcaggagcgatggcaatattggtatcgctaccgcgacgtcgggcgtcgccgcttct
atcatgcctggcggcaggactgcccactcgaggttcaagatcccattgagttgcgatgat
ggagcctcgtgcagcttcacgaagcagagtgggaccgccaagctgcttaggatggcctca
ttgataatatgggacgaggccagcatgacgaaacgacaagcggtcgaggcattggacaat
agcatgcgcgacatcatgggaatacgcgaccggccctttggaggaaagactgttgttttt
ggcggggactttaggcaggtgcttccggtcctcagaagggggtcgcggggccagataatt
gatgcaaccctacgaagttctcatctatggaagggtatgcggcagcttcggctcatcacc
aacatgagggctcataatgacacgtggtttgcaaattacttgctaagggtcggcaatggc
actgaggaagtcgacgatcaaggcaacatactactccctgaagacatttgtctgccgtct
acaggcgaggttgacgacctggagaagcttattcaccacgtgtttctgagtctagatgac
aacatgtatgattcaaattacatgacatctcgagcaatcctttccatgacaaacgacaat
gtcgacaagataaacatccgcatgatagagcgttttcagggagatgaagtaatataccat
agctttgacagtgcggaggacgacccatatggctactacgctcaggagtttccgaatgga
ttgactcctaacggtcttcctccgcatgcactcaagctaaagctgaactgccctgtcata
cttctaaggaacattgatccagaaaatggattgtgtaatggcactaggcttgttgttagg
ggttttgagaggaacaccattgatgcagaaatcgtgattggacaacacgctggcaggagg
gtcttccttcctcgaatacctctctgcccatctgaaaacgacatgtttccgttcaagttt
aagaggaagcaatttcctataaggcttagctttgctatgaccattaacaaggatcaaggg
cagacaatcctgattgttggtgtctacctacccaatcccgtgttctctcatggtcaactc
tatgttgctttgtctcgagccaccgcaaagagaaacataaagatactcattcagaaggag
aagccgaaggagaagtccaacaagcaaaaggacaatccaaagaagcgaaaaagaccgacc
atgtcattactaacctcgatgaagaacatcttctacaaggaagtccttacaggctga

DBGET integrated database retrieval system