KEGG   Aegilops tauschii (wheat D): 109742816Help
Entry
109742816         CDS       T04345                                 

Gene name
LOC109742816
Definition
(RefSeq) serine/threonine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ats00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    109742816 (LOC109742816)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ats01001]
    109742816 (LOC109742816)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ats03032]
    109742816 (LOC109742816)
   03400 DNA repair and recombination proteins [BR:ats03400]
    109742816 (LOC109742816)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109742816 (LOC109742816)
Protein kinases [BR:ats01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109742816 (LOC109742816)
DNA replication proteins [BR:ats03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109742816 (LOC109742816)
DNA repair and recombination proteins [BR:ats03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109742816 (LOC109742816)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC Sensor
Motif
Other DBs
NCBI-ProteinID: XP_020157500
LinkDB All DBs
Position
Unknown
AA seq 3015 aa AA seqDB search
MATARDVEEVVQKLASDRARPRDEGVKLLGTWLQGDRAPTFCRLLARNTARAKPGHLASG
ATWPFLITALAKCVLADIAAKRRGATRSAAAGMLRAAVRCAEDARLSGHSLLLVSVAKQL
FSHILEVIKDAPSFQLEYSPILRQLLTVKEYRYQMKPRTYSNLVVLYMKKVATGFDANFS
NQASSKEESFRCTWTLHVLLENPPGDYPDTMREEVLNGFCAIFSHIRREDGKLTSKLMEC
VNTFLLMDGPNLGDKSVEIHKAVQDFILRSWLMTRDLRLKSLFITYAKIQLKLARAIPKV
LERKNLLGVIMDDLDQNVNTEAGLLWCEASRDAKDVSLRCSLEELMDLSATIFYQAYKSP
TPIRGDDEKKLKTEDVISRITNSLKKGSLCWIGTTCLLVHKYGYRVDKSLLISWLQACCQ
SLKSALSKANVIRSQDSLLWIIRALKEFSAMFIVNTREESHCLLTKGEMSTVEGYWQDIW
NSLIHALPLFSPTALVADSALNLLGGMIMRDQVHTSVVSEDTWNLQTFKQSPSPSALYFI
ACYFSRIGLQGDLSNSSLVRKNLLRSTLELIQSVSKGSSLLNEQNVVMIPEAIFSICAGF
SSSAINSANASQLFDECKDFSKLLLESENWVIKDELGYSVEALSEISTESSTKVISDKCN
RAHLPGHIQQQLLDQLMEFEGFMASNEQLEKVDLCTLVYRCSLLCNLIHCALLSRAIEEN
SLFLKELFGHVTGIIKYIISMVMKKHEELSHGLTSVGSAFETAGSILSSFQTFLSAPIFR
LRSVSNRASSVLIKGVTVLLDELLVEFSQLFSRLSSSANNSDSENTSKMLPISSVNLSED
LNPFVDHKSVVDMDFDMTDSGEVDSITASGSGSIGISSRLLEWKLELVGVISTFFSVSAP
HTWEILYNLVEKESDVKVSHAILLNLCQNISASSKSLSSVVHLIFDMREKCASLLLGSAD
CLTHVHALLRTLMVTRDVGQNTDGKLQAYNEVSNENQDILLDLVTKGTEISITDWFFRIM
LIDCITHFIHLFPDGAQDMIGHFLNMLHDTDYRVRLYLARKMVVLFETWEGHDELFRDVC
SNIGVKMVQFSSEIPVKSREVLAVGPQSVPVIETVLITLAHLSVHSEEVEFECAFMISAV
AAIQPSQRKLEYALFDSISRKLSYASRSKYLDQLMGPILFRWVACEVSLVSLVKVQEMFG
FDTAKPKEFIEHICPWLLSFLILRGDAAGLNWISKTLLQPLSAVIKGYFVQIFGLCIAAK
NGTGPEKDLAETVLYESLLQLGEISEFERDDLIRKHMVSIVGVLLTVSSTARQSELPYFS
REILARTIKQVVDGFMDTADDDSADTVVIDKVNIFRADRVFKFLLAIHQQVTEAGHPRHM
SHRLFAIEVLIDVLGHRVVHYSTCFYIICIVGNYIWRQPLQGQCCNILSKLLVAFNANSS
TETVAVLGTQLQLLVPKLITCCLPNDQEGGRLNGDLSKVLSLLRQLTVDADPLLYDYIRD
LEPLPGLDCLKDIKVFHASLSDSYASRDQFLKFVHRAPHLPAELFLLSLRTHHKKLLSGE
IICRGDVSVGNADTVSCWRSDPDVVSAVWTLVGLCSSSSVANEASSVLADFISRAGISDA
HQVIFDVPNLTQKHSLQLQSGSTSKEDKLCSDYGISDDILLDLLKLLKTYLSDGSVEIIE
VTSRTLKGILSTSKGLNSLQCLDSLDRSLLMVHSRGINTQLVEQTLLGMDKYSTVPLEDS
DIWQTDGQPYEQWLCTLVSSLISHCDDIILRLCRSLVFLKVEAAELLLASALVNIAGNMD
SNSGICGLISSKVEKIIFCDSNYMMKSVKLFLDALNVVRSFYVTERARASPYNTRASPSP
YNTPKDGSRSARSKSRSPAATPSSSWRKVYWLSVDYLVAARAAQRCSCDFATLMYVELWC
EEQFNKLDLGPPDFSQQESLAPHIGLLVEAFTHINEPDSIYGITLANEVASQIIRYEHEG
NWSSALEYYDLLVRSTPKENLANFAGTVLTGPSVSSKAEENLLNWKMHKGLMRSLQKTGC
SHVLDIYSQGLTNQKACLQQDSEFVDIQYEAAWRAGNWDFSFFVPYSSQPSSRSRDYCLF
NENLHSCLRALQNGDSEQFQGKLSHSKMDLVLALSNASKESTKYIHSTVLKLQMLDHLSM
AWELRWKFCPDQAPKSNVGTEEFNLVPAVPKRNQLELLSKEWNFILCQTERNLDLFEPFL
AFRRGLLKILGSEEHLIEHLFQSASALRKGLRFSLAAASLYELKELCCHRDQQTVPSTYF
LSKLEEAKLLRAQGQHDMAIGLGKYILKNHTDERNKSDVYRLVGKWLAETRSSNSRTIIE
DYLNHSVALDKKYMSRQCRTHFHLAHYTYNLFKSYEERLSSNEWQAALRLRKYKTKELDT
LLKRLKNSSKAEKSDYGAKIQELQKQLALDREEAQKIQDDRDEFLSLALEGYQRSLVVGG
KYDLQVVFRLVSLWFNLFSRKQVVDSMIKTTKEVQSYKFIPLVYQIASRLGSSKDAQGST
NFQNALASLLKKMAIDHPYHTICQLLALANGDRVKDKQRSRSSFVVDMDKKLAAENLLKE
LSSFHGALIRQMKQMVEIYIRLAELETRKEDTNKKISLPREFRSICQLELAKVPVVTATI
PVDPNCRYEEGTFPHFSGLVDSITIMNGINAPKVIQCIGSDGNRYRQLAKSGNDDLRQDA
VMEQFFSLVNMFLQNHRDTSERRLRIRTYNVVPFTPSAGVVEWVNRTVPLGDYLLDSNRI
GGAHARYGTGDWTFLQCREHLACEKDKRKAFFKICDNFRPVMHHFFIERFLQPADWFQSR
LAYTRSVAASSMVGYIVGLGDRHSMNILIDEDTAEVVHIDLGVAFEQGLMLKTPERVPFR
LTRDIIDGMGVTGTEGVFKRCCEKTLSVMRENKEALLTIIEVFIHDPLYKWALSPLKALQ
RQKETEYNDSCLDDSQEACEGNKDAARAILRVKQKLDGYEDGEMRSVEGQVQQLIQDAVD
TDRLCQMFPGWAPWL
NT seq 9048 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcgcgcgacgtcgaggaggtcgtccagaagctcgcctccgaccgcgccagg
ccccgcgatgaaggggtgaagctgctggggacgtggctgcagggcgaccgcgcccccacc
ttctgccgcctcctcgcccgcaacaccgccagggccaagcccggccacctcgcctccggg
gccacgtggccgttcctcatcaccgcgctcgccaagtgcgtcctcgccgacatcgccgcc
aagaggcgcggagctaccaggagcgccgccgccgggatgctccgcgccgccgtccgctgc
gcagaggacgccaggctctcagggcactccttacttttggtttcagttgctaagcagctt
tttagtcatatattggaggtcataaaagatgctcccagctttcagctagagtacagccca
attctccggcagcttttgactgtgaaggagtaccgatatcagatgaaacctcgaacatac
agcaatcttgtagtgctctatatgaagaaggttgcgactggttttgatgcaaacttcagc
aatcaagccagctcaaaggaggaatccttccgctgtacgtggactctccatgttctactt
gaaaacccacctggcgattatcctgacaccatgagggaggaggttcttaatggattctgt
gcaatattctcacatattaggagggaggatggaaagctgactagcaagcttatggaatgc
gttaacacctttttactcatggatggaccaaaccttggagacaaatctgtggagatccat
aaagcagttcaagattttatattgcgttcgtggctgatgactcgtgatctgcggctgaag
agtttgttcatcacatatgcgaaaattcagttgaagcttgctagagctattccaaaggtt
ttggaaagaaaaaaccttcttggtgtcatcatggacgacctagatcaaaatgttaacact
gaagcaggtttattatggtgtgaggcatctcgagatgcgaaagacgtgtccttaagatgc
tccttggaagagttaatggatctatctgctactattttttatcaggcatataaatccccc
acaccaattagaggagatgatgagaaaaaattgaagacggaggatgttattagccgcatc
acgaatagcctaaaaaaaggatctctatgttggattggtaccacatgtcttcttgttcac
aagtatggatatcgagtggacaaatctttgttgatcagttggctccaagcatgttgtcaa
tctttgaaaagtgctttgagcaaggcaaacgtcatacgttctcaggattcactgctttgg
attatcagggcacttaaggagttctctgcgatgttcatagtgaatactagggaggaatca
cattgtttattaacaaaaggcgagatgtcaactgttgaaggttattggcaagatatctgg
aattccctcattcatgcacttcctttgtttagccccacagctctagtggctgattcagct
ctaaatctgttgggtggaatgatcatgcgggatcaagtccatacttcagttgtgtcagaa
gatacatggaacctgcaaacttttaaacaatcgccatcaccgtctgctctgtacttcatt
gcttgttacttctcaaggattgggttgcagggcgatttatccaattctagccttgttcga
aagaatctgctaagatcaactttggagttgattcagtcagtgtcaaagggatcctctctt
ttaaatgagcaaaatgttgtgatgattcctgaagccattttttctatctgtgctggtttt
tcatcatcagccattaactcagcaaatgcatcccaactgtttgatgaatgcaaggatttc
tcaaagttgttactcgagagtgagaattgggtcatcaaagatgaactaggttactctgtg
gaagccttatcagaaatcagtactgaaagttctaccaaggttatatctgataaatgcaac
cgagcacaccttcctgggcacatccaacagcaattgcttgatcagcttatggagttcgaa
ggatttatggcctcaaatgaacagcttgagaaagtggacttatgtactcttgtataccgt
tgttccctcctctgcaatctaattcattgtgcactattgtcaagggcaatagaagaaaat
tctttatttcttaaagaattatttggtcatgttactggcatcataaaatatattatatca
atggttatgaaaaagcacgaggaactatctcatggtcttactagtgtaggctctgcattt
gagacagccggctccattttatcctcatttcagaccttcctctctgctccaatttttaga
ctgcggagtgttagtaacagagccagctctgtgcttattaaaggtgtcactgtattgctt
gatgaactattggtggaattctctcagttgttttctcgtctttctagctctgcgaataat
tctgatagtgagaacactagtaaaatgttgccaatatcttctgtcaacttgtcagaagat
ctaaatccttttgttgaccacaaaagtgttgttgatatggattttgatatgacggactct
ggtgaggttgactctatcacagctagtggaagtggaagtattggtatctcgtcacgcctt
ttggagtggaagcttgaactagttggtgttatttcaacttttttctcagtgtcagcaccc
catacatgggaaatcttgtacaacttagtggagaaagagagtgatgtcaaggtctcccat
gccatcctgcttaatctttgtcaaaatatctccgcttcatctaaaagtttatcttctgtg
gtccatttgatattcgatatgagggagaaatgtgcaagtttactacttggttctgctgac
tgcttaacacatgtacatgccttgttaagaactttaatggttacacgtgatgttggacaa
aatactgatggaaagctgcaagcatataatgaggtttcaaatgagaaccaggacattcta
ttagacttggtgactaaaggtactgagatcagcatcacagattggtttttccggatcatg
ctcattgattgcatcacccactttattcacttgttccctgatggtgcccaggatatgatt
ggacatttcctcaacatgctgcatgatactgattatcgtgttaggttgtatctggctagg
aaaatggttgtgctattcgaaacatgggaaggacatgatgagttgtttcgtgacgtttgc
tcaaatattggtgtcaagatggtgcagttctccagcgagattccagttaaatctagagaa
gtcttagctgttggtccacaatctgttccagttattgaaactgtcctcattacattagct
catttgtctgtgcatagtgaggaggttgaatttgagtgtgcattcatgatttctgctgtt
gctgctatacagccttctcagcgaaaattggaatatgctttatttgattctatctcaaga
aagctcagttacgcttcacgaagcaagtatttggaccaactgatgggtccaattctcttc
cggtgggttgcctgtgaagtgagcctagtttcgcttgttaaggtgcaagagatgtttggt
tttgatacggccaagccaaaggagttcattgaacatatttgcccatggcttctttcgttc
cttattctcaggggtgatgccgctggccttaattggatatccaagacgttgttacaacct
ttatctgctgtcatcaagggatattttgttcagatctttggattgtgtattgccgccaaa
aatggcactgggccagagaaggacttggcagaaactgtcttatacgaatcacttttacag
cttggcgaaatttctgagtttgagcgtgatgatctcattagaaaacatatggtttccatt
gtgggcgttttgctcacagtttcatccactgctcgccaatcagaattgccatacttttcc
agggagattttagcacgcacaatcaaacaagttgttgatggattcatggatacagcggat
gatgattcggctgatacggtggttattgacaaagttaatatattccgtgctgacagagtt
tttaagttcctgttggcaatacatcaacaagttacagaagcaggccatcctaggcacatg
agtcatcggctttttgcgattgaggttttaatagatgtacttgggcacagagtggtacat
tatagcacttgcttctatattatttgtatagtggggaattatatctggaggcaaccattg
caaggccagtgctgcaacattttatctaaattgttggttgctttcaatgcaaactcatct
acagaaactgtcgctgtgcttggcacgcagctccagcttttggttcctaaattaatcacc
tgttgcctacctaatgatcaagaaggagggcgtctcaatggggatttgtcgaaagttcta
tctttgcttcgtcaattaacagttgatgctgatcccttgctttatgattacatacgagat
ttggaaccacttcctggtcttgattgcttgaaagatataaaagttttccatgcttcactt
tctgactcatatgcctcaagagaccagtttctgaagtttgttcacagggctcctcacttg
cctgcagaattatttttgctgagtcttcgtacacatcacaagaagttattatcgggagaa
atcatctgcagaggcgatgtatctgtcggtaatgctgacacagttagttgctggcgcagc
gacccagatgttgtttcggctgtatggactcttgttggcctttgcagctcatcatctgtt
gcaaatgaagcttcttcagtgcttgctgattttatctctagggctggtatatctgatgct
catcaagtaatattcgatgttccaaatcttactcaaaagcactccttacaacttcaaagt
ggttctacttccaaggaagataaattgtgttcagactatggtatttctgatgatatcttg
cttgatcttctgaaacttttgaagacttatttatcagacgggtctgtcgaaataatagaa
gttacttcacggacattgaaggggattctgtcaacatcgaagggcctcaattctctgcag
tgtcttgattctcttgatagatctttactgatggttcattcaaggggaataaacactcag
ttagttgagcagacacttttggggatggataagtattctactgttccacttgaagattca
gacatctggcagactgatggtcagccgtatgagcaatggttatgtaccctagtgagctcg
ctcatttcccattgtgatgacatcatcctaagactttgtagaagtcttgtttttcttaaa
gttgaggctgctgagcttttgctggcaagtgctctggtgaacattgctggcaatatggat
tctaatagcggcatttgcggattaatttcatcaaaggttgagaaaataattttttgcgac
tcgaattatatgatgaaatcagttaagctatttctggatgcactgaatgttgtcagatct
ttttatgttaccgaacgagccagagcttccccttataatactagagcttccccctcccct
tacaatactccgaaggatggtagtagatccgctagatccaaaagtaggtcaccagcggca
acgccgtcatcttcatggaggaaggtgtactggctttcggttgattatcttgtagctgcc
agagctgctcaacgttgctcatgtgactttgcgacgcttatgtatgttgaactttggtgt
gaggaacaattcaataagctggacctaggacctccagatttttcacagcaagagtcgttg
gcaccacatattgggctattggttgaggcatttactcacataaatgagccggacagcatt
tatggaataacactggccaatgaggtagcttctcaaatcatcagatatgagcatgagggt
aactggagcagcgctcttgaatattatgatttactagtaagatcaaccccgaaggagaac
cttgccaattttgctgggacagtgttgactggaccatctgtgtcttctaaagcagaagag
aatctgctgaactggaaaatgcacaaaggtctgatgaggtcattgcagaaaactggatgt
agccatgtgcttgatatttacagccaagggttaaccaaccaaaaagcgtgccttcaacag
gattcagagtttgttgatatacaatacgaagctgcttggagggcaggaaactgggatttc
tccttttttgttccatactcttcgcagccttcaagccgctcccgcgattattgtcttttc
aatgaaaatttgcacagttgcctaagagctcttcagaatggtgattctgagcagttccag
gggaaactttcccattccaaaatggatcttgtgttggctctttcaaatgctagcaaggag
agcacaaaatacatccactctaccgttctcaaattacaaatgctagatcatctttctatg
gcatgggagctgcgctggaaattttgtcccgaccaagctccaaaatctaatgttggaact
gaggaattcaatcttgtgcctgctgtacccaagaggaatcagctggagttgttgagtaaa
gagtggaatttcatcctgtgtcaaacagaacgtaaccttgatctttttgaacccttttta
gcattcagacgtggcctcctcaagatcttaggttctgaagaacatctcatagaacattta
tttcaatccgcttctgcactccggaagggattaaggttttctttggctgcggcttcctta
tatgaactcaaagaactttgctgtcacagagatcagcaaactgtgccaagcacttatttc
ctgtcaaagcttgaagaagctaaactgctgagagctcaggggcagcatgatatggctatt
ggtcttggtaaatacatactgaagaaccatactgatgagagaaacaaatcagatgtctac
cgattggttggcaagtggttggctgaaacaagatcgagcaactccagaacaatcattgaa
gactacctaaaccactctgtagctcttgacaaaaagtacatgtccaggcagtgtcgcacg
cattttcatttagcacattacacatacaacttgttcaaaagctacgaggaaagactttca
tccaatgaatggcaagccgctctgcgtttaaggaaatacaagactaaggagttggatacg
ctgcttaaaagactcaaaaattcatccaaggctgagaaaagtgattacggtgcgaaaatc
caagagttgcagaaacaacttgcacttgacagagaagaagcacagaagattcaggatgat
cgagacgagttcttgagtctagcacttgaggggtaccaacgttccctagtcgttggtggc
aaatatgacctacaagtggttttccggttggtatcactgtggtttaatctcttctcaagg
aaacaagttgtggactcaatgattaaaacaacaaaagaggtccaaagctacaagttcata
ccattggtctaccagattgcttctagacttgggagttcaaaagatgctcaggggtcaaca
aacttccagaatgcattagcttctctcttgaagaaaatggccattgatcatccatatcat
acaatatgtcagcttttggctctagcaaatggtgaccgtgtcaaagacaagcaaagaagt
agaagttcttttgttgtagatatggacaagaagcttgctgctgagaatctattaaaggag
ctatcttcttttcatggggctttgattcgtcagatgaagcaaatggttgagatctacatt
aggttagcggaactggagactaggaaggaggacactaacaaaaaaatctcactacccagg
gagttccgcagcatttgccagcttgaacttgcaaaggttcctgttgtgactgctactatt
ccagttgaccctaattgtcggtatgaagaaggtacctttccacatttcagtgggctggtg
gattctattactataatgaatggaattaatgctccaaaagttattcagtgtattggctcg
gatggtaacagataccgccaacttgcaaaatctggaaatgatgacctgcgacaagatgct
gttatggagcaatttttcagtttggtaaatatgttcttgcaaaatcacagagatacttcg
gaaaggagattgcgaatacgcacatataatgttgttcctttcaccccaagtgctggtgtc
gttgaatgggtaaataggactgttccgcttggtgactatctcttagacagcaatagaatt
ggcggagcacatgcacgatatggaactggagactggacatttctgcaatgtagagagcac
ctggcgtgtgagaaagacaaaaggaaggcgtttttcaaaatctgcgacaactttaggcct
gtgatgcaccatttcttcattgagagattcttgcagcccgcagactggttccaaagtaga
cttgcgtacacaagaagtgtggcagcaagctcaatggtgggatatattgttgggcttgga
gatcgccattccatgaacattctcattgatgaagacacagccgaggttgtgcacattgat
cttggtgttgcatttgagcagggtctcatgcttaaaacacctgaacgggttccattccgg
ctgacaagggacatcatagacggcatgggcgttactggcactgaaggtgtattcaaaaga
tgctgtgagaaaactctgtctgtaatgagagaaaataaagaggcattgcttaccattatt
gaagtcttcatccatgatcctctttataaatgggccctttcgccactgaaagccttacag
cgtcagaaggaaactgaatacaatgactcgtgcctggatgattctcaagaggcgtgcgag
ggcaacaaggacgcggcccgtgcgatactccgcgtcaaacagaagctggacggttatgag
gacggcgagatgaggagcgtagaggggcaggtccagcagctcatacaggacgcggtagac
actgatcggttatgccagatgttcccagggtgggcaccttggctgtga

DBGET integrated database retrieval system