KEGG   Aegilops tauschii (wheat D): 109749016Help
Entry
109749016         CDS       T04345                                 

Gene name
LOC109749016
Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00010  Glycolysis / Gluconeogenesis
ats00053  Ascorbate and aldarate metabolism
ats00071  Fatty acid degradation
ats00280  Valine, leucine and isoleucine degradation
ats00310  Lysine degradation
ats00330  Arginine and proline metabolism
ats00340  Histidine metabolism
ats00380  Tryptophan metabolism
ats00410  beta-Alanine metabolism
ats00561  Glycerolipid metabolism
ats00620  Pyruvate metabolism
ats00903  Limonene and pinene degradation
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109749016 (LOC109749016)
   00053 Ascorbate and aldarate metabolism
    109749016 (LOC109749016)
   00620 Pyruvate metabolism
    109749016 (LOC109749016)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109749016 (LOC109749016)
   00561 Glycerolipid metabolism
    109749016 (LOC109749016)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109749016 (LOC109749016)
   00310 Lysine degradation
    109749016 (LOC109749016)
   00330 Arginine and proline metabolism
    109749016 (LOC109749016)
   00340 Histidine metabolism
    109749016 (LOC109749016)
   00380 Tryptophan metabolism
    109749016 (LOC109749016)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109749016 (LOC109749016)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    109749016 (LOC109749016)
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109749016 (LOC109749016)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: XP_020163600
LinkDB All DBs
Position
Unknown
AA seq 549 aa AA seqDB search
MAAAATRRAASSLASRCLLSRPAASPAAVPSALRRADGARGLLPGLLQRFGTAAAAEEPI
SPSVQVGETQLLINGKFVDAASGKTFPTVDPRTGEVIARVAEGDAEDVDRAVVAARKAFD
EGPWPRMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAAHIEVPMLARLMRYY
AGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGWKVGPALACGNTIVLK
TAEQTPLSALYVSKLLHEAGLPEGVLNIVSGFGPTAGAALASHMDVDKIAFTGSTDTGKV
ILELSARSNLKPVTLELGGKSPFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHE
RVYDEFVEKSKARALKRVVGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGD
KLGDKGYYIQPTIFSDVQDGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVF
TNNLDTANTLTRALRAGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVV
TALKNPAWL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgccgccacgaggagggccgcctcctcgctcgcctcccgctgcctgctctcc
aggcccgcagcgtcgcccgctgctgtcccctccgcgctccgcagggcagatggggcacgt
ggattgttgccaggactccttcagaggttcggcactgcggcagcagcagaggagcccatt
tcgccttctgtccaagtgggcgagacacagctccttatcaacggcaaattcgtcgatgct
gcatctggtaaaactttcccgactgtggaccctcgcaccggggaggtgattgcccgtgtg
gccgaaggagatgccgaagatgttgaccgtgcggttgttgctgcccgcaaggcattcgat
gaagggccatggcccaggatgactgcctatgagagatcccgcattcttctgcggtttgct
gatttgatagagaaacacaatgacgatatcgctgcactggaaacgtgggacaacgggaag
ccctatgagcaagctgcccacatcgaagtgccgatgcttgcccggcttatgcggtactat
gcaggctggactgacaagatccatggtctcatcgtaccggctgatggcccgcaccatgta
caggtgctgcacgagccgattggtgtcgtgggtcagatcatcccgtggaacttcccactt
ttgatgtatggctggaaagttggccctgctttggcatgtggaaacactattgtcctcaag
actgccgaacaaactcctctatctgctctctatgtttctaagctgttgcatgaggctgga
ctacccgaaggtgtcctgaacatcgtatctggtttcggtcctactgccggggctgctctt
gctagccacatggatgttgacaagattgcattcactggatcaaccgatactggaaaagtt
attcttgagttatctgcacggagcaatcttaagccagtgacactggagctaggaggcaag
tctccttttatcgtcatggatgatgcagatatcgaccaagccgttgagcttgcgcatttt
gcgctgttttttaaccagggacaatgctgctgcgctgggtctcgcacgttcgtacatgag
cgtgtttatgatgagtttgttgagaagtccaaggctcgcgctttgaagcgtgtagttggt
gatccattcaggaagggtgttgagcagggtcctcagattgatgatgagcaattcaagaag
atcttgcgctacatcaagtcgggtgtggacagtggagccacccttgtgacgggtggtgac
aagttgggtgacaaaggttactacatccagccaacaattttctcagatgtgcaggatggc
atgaaaattgcccaagaggagatatttgggcctgttcagtcaatcttcaagttcaatgac
ctcaacgaggtgatcaagagggcgaacgcaagccagtacggattggctgccggtgttttc
accaacaacctggacacggccaacaccttgacgcgtgccctcagggccggcacggtctgg
gtgaattgctttgacatcttcgacgcggcgatccccttcggcgggtacaagatgagcggc
atcggtagggagaagggcattgacagcctgaagaactacctgcaagtcaaggcggtcgtc
accgcgcttaagaaccccgcgtggttgtga

DBGET integrated database retrieval system