KEGG   Aegilops tauschii (wheat D): 109750104Help
Entry
109750104         CDS       T04345                                 

Gene name
LOC109750104
Definition
(RefSeq) alpha-amylase type B isozyme-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109750104 (LOC109750104)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     109750104 (LOC109750104)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: XP_020164650
LinkDB All DBs
Position
Unknown
AA seq 427 aa AA seqDB search
MANKHPSLSLFLLLLGLSSSLASGQVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTH
VWLPPASQSVSKQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAE
RKDGRGIYCIFEGGTPDARLDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRV
QKELVEWLNWLRTDVGFDGWRFDFAKGYSADVAKIYIDRSEASFAVAEIWTSLAYGGDGK
PNLNQDPHRQELVNWVNKVGGSGTGTTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGW
WPAKAVTFVDNHDTGSTQHMWPFPSDSVMQGYAYILTHPGTPCIFYDHFFDWGMKDEIYR
LVSIRTRQGIHSESKLQIMEADADLYLAEIDGKIIVKLGPRFDVGHLIPGGFKVAAHGKD
YAVWEKI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaaacacccgtccctctccctcttcctcctcctcctcggcctctcgtccagc
ttggcctccggtcaagtcctgtttcagggtttcaactgggagtcgtggaagcacaatggc
ggatggtacaacttcctgatgggcaaggtggacgacatcgccgcggccggcgtcacgcac
gtctggctgcccccggcgtcgcagtccgtctccaagcaagggtacatgcctggccggctc
tacgacctggacgcctccaagtacggcaacaaggcgcagctcaagtccctcatcggggcg
ctccacggcaagggcgtcaaggccatcgccgacatcgtcatcaaccaccgcacggcggag
cgcaaggacggccggggcatctactgcatcttcgagggcggcacccccgacgcgcgcctc
gactggggcccccacatgatctgccgcgacgaccggccctacgccgacggcaccggcaac
ccggacaccggcgccgacttcggggccgcgccggacatcgaccatctcaacccgcgcgtg
cagaaggagctcgtcgagtggctcaactggctcaggaccgacgtcggcttcgacggctgg
cgcttcgacttcgccaagggctactccgccgacgtggccaagatctacatcgaccgctcc
gaggccagcttcgccgtggccgagatatggacgtcgctcgcgtacggcggggatgggaag
cccaacctcaaccaggacccgcaccggcaggagctggtgaactgggtgaacaaggtgggc
ggctccggcacgggcaccacgttcgacttcaccaccaagggcatcctcaacgtcgccgtg
gagggcgagctgtggcggctgcgcggcaccgacggcaaggcgccgggcatgatcgggtgg
tggccagccaaggcggtgaccttcgtcgacaaccatgacaccggctccacgcagcatatg
tggcccttcccttccgacagtgtcatgcagggatacgcgtacatcctcacgcacccaggg
accccgtgcatcttctacgatcatttcttcgactggggcatgaaggacgagatctatcgc
ctagtgtcaatcaggacccggcaggggatacacagtgagagcaagctacaaatcatggag
gctgacgccgacctttaccttgccgagatcgacggcaagatcatcgtcaagctcgggcca
cgattcgatgtggggcacctcattcccggaggcttcaaggtggccgcacacggcaaagac
tatgccgtatgggagaaaatataa

DBGET integrated database retrieval system