KEGG   Aegilops tauschii (wheat D): 109751814Help
Entry
109751814         CDS       T04345                                 

Gene name
LOC109751814
Definition
(RefSeq) superoxide dismutase [Cu-Zn] 4A
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ats00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109751814 (LOC109751814)
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109751814 (LOC109751814)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: XP_020166288
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKAVAVLTGSEGVKGTIFFTQEGDGPTTVTGSVTGLKEGLHGFHVHALGDTTNGCMSTG
PHFNPAGHVHGAPEDEIRHAGDLGNVTAGADGVANINVTDCHIPLTGPNSIVGRAVVVHG
DADDLGKGGHELSKSTGNAGARVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggctgtgcttaccggcagtgagggtgtcaagggcaccatcttcttc
acccaggagggagatggcccgaccaccgtgacgggaagcgtcactggactcaaggaaggg
ctccacggcttccacgtgcacgctcttggtgacaccaccaacggctgcatgtcaactgga
ccacacttcaaccctgctggtcatgtgcatggggcaccagaagatgaaatccgccatgct
ggtgatcttggaaatgtgacagctggagcggatggtgttgctaacatcaatgttactgac
tgccatatcccccttactggaccaaattcaattgttggccgtgctgttgtcgtccacggt
gacgctgatgatcttggcaagggtggacatgagcttagcaagagcactggaaacgctggt
gcgcgtgttgcttgcggaatcatcgggctccagggctaa

DBGET integrated database retrieval system