KEGG   Aegilops tauschii (wheat D): 109753010Help
Entry
109753010         CDS       T04345                                 

Gene name
LOC109753010
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00020  Citrate cycle (TCA cycle)
ats00190  Oxidative phosphorylation
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
ats01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109753010 (LOC109753010)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109753010 (LOC109753010)
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109753010 (LOC109753010)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: XP_020167531
LinkDB All DBs
Position
Unknown
AA seq 621 aa AA seqDB search
MWRSRVSRGLREAKAAAAAASRRFSTTSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGF
NTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIQYMCRE
APKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLY
GQAMKHNTQFFVEYFALDLIMDKEGTCQGVIALNMEDGTLHRFRSTNTILATGGYGRAYF
SATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGE
RFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPMKDHLYLHLNHLPPEVLKERLPGIS
ETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVDIKGDNPDTIIPGLMAAGEAAC
ASVHGANRLGANSLLDIVVFGRACANRVAEISKPGGTQKPLEKDAGEKTIAWLDKLRNAN
GSLPTSKIRLNMQRIMQNNAAVFRTQETLTEGCELISEAQKSFHDVKLSDRSLIWNSDLI
ETIELENLLINACITMHSAEARQESRGAHAREDFKTRDDDKWMKHSLGYWEDEKVRLEYR
PVHMNTLDDEVETFPPKARVY
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcagccgcgtgtcgcggggcctccgggaggccaaggccgccgccgccgccgcg
tccaggcgcttctccaccacctcgtcctacacggtggtggatcacacctacgatgcggtc
gtggttggcgctggaggcgcggggctcagggccgcgattgggctctcggagcatgggttc
aacaccgcctgcatcaccaagctcttccccacgcggtcacataccgtggcagcgcaggga
ggtataaacgctgctcttggaaacatgagtgaagatgactggaggtggcatatgtatgat
acagtcaagggaagtgattggctcggtgaccaagatgctatccagtatatgtgtagagaa
gcaccaaaggctgttatagagcttgagaactatggattaccattttccagaactgaagat
ggaaaaatttatcaacgcgcttttggaggccaaagcttagattttggaaaaggtggtcag
gcctatcgatgtgcatgcgctgctgacagaacagggcatgctatgctacacacactttat
gggcaggcgatgaagcacaatactcagttttttgttgaatattttgcgctggaccttatc
atggacaaagaaggcacctgccagggggtaattgcactaaacatggaggatggtaccctt
catcgtttccgttcaacaaatactattttagcaacaggaggttatggcagagcttacttc
tctgctacttcagctcacacatgtactggtgatggcaatgctatggttgcacgtgctggg
ttaccccttcaggatcttgagtttgtgcagttccatcctacaggcatttacggtgctgga
tgccttataactgaaggttcccggggcgaaggtggtattcttaggaacagcgaaggtgag
aggttcatggaacgatatgcccctaccgctaaagatcttgcatctcgtgatgttgtttca
agatctatgactatggaaattagagaaggacgtggtgtaggaccaatgaaggaccatctc
tacctgcaccttaatcatcttcctccagaagttctgaaggaaaggcttcctggtatatct
gagactgctgctatttttgctggtgttgatgtcaccaaagagcctattcctgttttgccg
actgtgcattataatatgggcggtatccctacaaattatcatgggcaggtggtggatatc
aagggtgataacccagacacaattattcctggtctgatggctgctggggaggcagcttgt
gcatctgttcatggtgcaaaccgtcttggtgcaaattcacttcttgacattgttgtattt
gggagggcttgtgcaaatagggttgctgagatttccaagccaggagggacacagaaacct
cttgaaaaagacgcaggggagaagaccatcgcttggttggacaagctgagaaatgctaat
ggatcactgccaacttcgaagatccgcctcaacatgcaacgtattatgcaaaataatgct
gcagttttccgcacacaggaaactctaacagaaggttgcgagctgattagtgaagcacag
aaaagtttccatgatgtcaagctcagtgacagaagtctcatatggaattcggatttgata
gagaccatagaattagaaaacctgctaataaatgcatgcataaccatgcattcagctgag
gctcgccaagagagcagaggagctcatgctcgtgaagatttcaagacaagagatgacgac
aagtggatgaagcactcgctagggtactgggaggatgaaaaggttagactagaatacagg
ccagttcacatgaacaccttggatgatgaagtcgagactttcccgccgaaggcacgtgtt
tactaa

DBGET integrated database retrieval system