KEGG   Aegilops tauschii (wheat D): 109754250Help
Entry
109754250         CDS       T04345                                 

Gene name
LOC109754250
Definition
(RefSeq) cinnamoyl-CoA reductase 2-like
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00940  Phenylpropanoid biosynthesis
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    109754250 (LOC109754250)
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     109754250 (LOC109754250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NmrA NAD_binding_4 Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: XP_020168747
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MPIESTDNVPADLPGHGRTVCVTGAGGFIASWLVKRLLQKGYTVRGTVRNPVDPKNDHLR
AFDGAADRLVLLRADLMEPETLVEAFTGCEGIFHAASPVTDDPEKMIEPAIRGTKYVITA
AADMGIKRVVFTSTIGTVYMNPHRDPSKPVDDTCWSDLEYCKKTANWYCYAKTVAEQDAL
ETARQRGIELIVVNPVLVLGPLLQPTVNASTEHVMKYLTGSAKTYVNAAQAYVHVKDVAE
AHVRVYEAPGAHGRYICAEGTTLHRGELCRVLGKLFPEYPVPTKCKDEVNPPVKGYKFTN
QRLKDLGMEFVPVLQSIYETVKSLQEKGMLPVLPPGDDVRDNLHEQLMMKPAQLLRN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgagtcgacagacaacgtaccggccgaccttcccggccacggccggacggtg
tgcgtcaccggcgccggcggcttcatcgcctcgtggctcgtcaagcgcctcctccagaag
gggtacaccgtgcggggcaccgttcgcaaccctgttgatccgaagaatgaccacctgaga
gccttcgacggcgccgccgaccgcctcgtcctcctccgcgccgaccttatggagcccgaa
accctcgtggaggcgttcacgggctgcgagggcatcttccacgccgcttcccccgtcacc
gacgaccctgagaagatgatcgagccggcgatccgggggaccaagtacgtgatcacggcg
gccgcggacatgggcatcaagcgtgtggtgttcacgtccaccatcggcacggtgtacatg
aacccccacagggaccccagcaagcccgtcgacgacacctgctggagcgaccttgaatac
tgcaaaaagacagcgaactggtactgctacgcgaagacggtggccgagcaggacgcgctg
gagacggcccggcagcgcggcatcgagctgatcgtggtgaacccggtgctggtgctgggc
ccgctgctgcagccgacggtgaacgcgagcacggagcacgtgatgaagtacctgacgggg
tcggccaagacgtacgtgaacgcggcgcaggcgtacgtgcacgtcaaggacgtggccgag
gcgcacgtccgcgtctacgaggcgcccggcgcgcacggccgctacatctgcgccgagggc
accacgctccaccgcggcgagctctgccgcgtcctcggcaagctcttccccgagtacccc
gtacccaccaagtgcaaggacgaggtgaacccaccggtgaaagggtacaaattcacgaac
cagaggctcaaggacctggggatggagttcgtgccggtgctgcagagcatatacgagacg
gtgaagagcctccaggagaaagggatgctgccggtgctaccgccaggcgacgacgtccga
gacaacctgcatgagcagctcatgatgaagcccgcccagttgctacgtaattaa

DBGET integrated database retrieval system