KEGG   Aegilops tauschii (wheat D): 109763790Help
Entry
109763790         CDS       T04345                                 

Gene name
LOC109763790
Definition
(RefSeq) exonuclease 1 isoform X1
  KO
K10746  exonuclease 1 [EC:3.1.-.-]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ats00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    109763790 (LOC109763790)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ats03032]
    109763790 (LOC109763790)
   03400 DNA repair and recombination proteins [BR:ats03400]
    109763790 (LOC109763790)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     109763790 (LOC109763790)
DNA replication proteins [BR:ats03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109763790 (LOC109763790)
DNA repair and recombination proteins [BR:ats03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     109763790 (LOC109763790)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I XPG_N XPG_I_2 5_3_exonuc MIT
Motif
Other DBs
NCBI-ProteinID: XP_020178265
LinkDB All DBs
Position
Unknown
AA seq 875 aa AA seqDB search
MGIQGLLPQLKSIMAPIRVEDLRGQTVAVDTYSWLHKGALSCGDRLCKGIPTTRHIEYCM
HRVNLLRHHGVKPILVFDGGFLPMKSEQEIKRARSRKENLERAREHEAAGNSRAAFDCYQ
KAVDITPKIALELIQVLKQEKVDYIVAPYEADAQMTFLSVNKLVDAVITEDSDLIPFGCS
RIIFKMDKFGQGVEFQITRLEQNRELDLNGFTKQMLLEMCILSGCDYLPSLPGMGVKRAH
ALIQKLKSHEKVIKHLRYSAVSVPPQYEENFKKAIWAFQFQRVYDPATEDIVHLSGIPHD
LSEDDFLGPWLPQAVVKGIALGEIDPLTKEPFEASIPSSAPAADKGYPVKESIIPSNGKK
RLELPVQKNILTNYFCLASLEAKRKFRAPKVTPKQKMLNESSLPSPQTEHSGTPDSIEDT
SLPMNNIQFSQYSSEHFSSEPPRDDSIDASQCSTGRAFPWDDSDSVSPHCSSRDIGNGPL
SRDQRIEDAEVEVSYCNTSPMPISPCLERTSPGIADPSLVSHNTEPLRPVPHYAESYVAP
TVRSSYFKKDKRVFTNQAENQFDDDDDNAETGTSTLSGVQPGNPGGVVKRRKLWDPQNFE
DETLPPTSSHDSPAVDEGCGTDSLDDIDTNSEGRFGCNVSHVNNYSGIAEKSMDKFAALI
SSFRYAGSRASGLRAPLKDVKNTLSVRSILRPPEQNLRCTAKKTARGHRSQSRSRSDASN
SADGPPDLSAFAHSPVFLPDLGKVTDKDAPARSTTGGCPDQSKNTRKAVGTAVSPPDLST
FAYTPTTTASRPERSKFSTAIRTADSPDLSTFAYRPTTTASRSEQSKLSPTAIRTADSPP
DLSTFAYKSMKPLDGSRFAGTTLAASGRNSRGRFT
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggggatccagggtttgctgccgcagctcaagtcgataatggcgcccatcagggtggag
gacctgagggggcagacggtcgccgtcgacacctactcctggctccacaagggcgccctc
tcctgcggcgaccgcctctgcaagggcatccccaccaccaggcatattgagtactgcatg
catagggtcaacttgttgcggcaccatggcgtgaagccaattcttgtatttgatggaggc
tttctgccaatgaagagcgaacaagagatcaaacgtgcaaggtcacgaaaggaaaatctt
gagcgtgccagggaacatgaagcagctgggaattcccgtgctgctttcgactgctaccag
aaagctgttgatattacacctaaaattgctttagaactgatccaggtactgaagcaagaa
aaggttgattatattgttgcaccttacgaagcagatgcacaaatgacattcttatctgtc
aacaaacttgttgacgctgtaattaccgaggattcagatttgataccatttggctgttct
agaattattttcaagatggacaaatttgggcaaggtgttgaattccagataacgcgattg
gaacaaaacagggagctggacttaaatggattcacgaaacagatgttactagagatgtgt
attttaagtggctgtgactatcttccatccttgccgggaatgggtgtcaaacgtgctcat
gcactcatccaaaaacttaagagtcatgagaaggtaatcaagcacctgaggtacagtgct
gtttctgttccacctcaatatgaagagaatttcaagaaggcaatatgggcatttcagttt
caaagggtctatgatcctgcgacagaagatattgttcatttgtctggcattcctcatgac
ctcagcgaagacgactttctgggcccatggttaccacaggctgttgttaaaggtattgct
ctaggggaaattgatccacttacaaaggaaccatttgaggccagcattccttccagtgca
cctgctgctgataaaggttatccggtcaaggagtctattattccttcaaatggaaagaag
aggctagaattgcctgtgcagaaaaacatattgacaaattacttctgcttagcatcgctt
gaggcaaaacggaagttcagggcacctaaggttacacccaagcaaaaaatgttgaatgaa
tcttctttgccgagccctcagactgaacactctggcacccctgattcaattgaagacact
agcttgccaatgaataatattcaattctctcagtatagttctgagcattttagctctgaa
cctcctcgagatgattcaattgatgcttctcaatgtagtactggtcgtgccttcccctgg
gatgattcagatagtgtttcaccacactgtagttctcgtgatattggcaatggtcctctt
tctagggatcaacgcattgaagatgcagaggttgaggtcagttattgcaacacaagtcca
atgccaataagtccttgcttagagaggacttcgcctgggatagcagatccatcattagtt
tctcacaacacggagccattgagaccagtgccacattatgctgaaagttatgtggctcct
actgtaaggagttcatacttcaagaaggataagagggttttcacaaatcaagcagaaaac
cagtttgatgatgatgatgataacgccgagactggcacttccactctttctggagttcaa
ccggggaaccctggaggtgttgtgaagagaagaaaactttgggatccccaaaattttgaa
gacgaaacattgccgccaactagttcacatgacagtccagcagttgatgaaggctgtggt
actgattcccttgatgacatcgacacaaattctgaaggaagattcggatgcaatgtttcc
catgtgaataattacagtggcattgcggagaaatcgatggataagtttgctgcactgata
tcgtctttcagatacgcaggctcccgtgccagtggccttcgtgctcctttaaaggatgtg
aagaataccctttctgtgagatctattctcagacccccggaacagaacctccggtgtacg
gctaagaagaccgcgagaggtcatcgttcacaaagcagatccagaagtgatgcctcgaat
agcgccgatggtcctcctgatctgagcgcgtttgcacacagccctgtttttcttcctgat
ctggggaaggtcaccgataaagatgcaccggcaagatctactactggtggttgtcctgat
caaagcaagaacactcgtaaagcagtgggcactgctgtcagtcctcctgatctgagcaca
tttgcatacacacccacgactactgctagtcgtcctgaacggagcaaattctctacagct
ataagaactgcagacagtcctgatctgagcacatttgcataccgacccacgactactgct
agtcgctctgagcagagcaaattgtctcctacagctataagaaccgctgacagtcctcct
gatctgagcacatttgcatataaatccatgaaacctttggatggcagcaggtttgcaggg
acaacattagcagcttctggacgaaattctcgaggccgattcacatag

DBGET integrated database retrieval system