KEGG   Aegilops tauschii (wheat D): 109764751Help
Entry
109764751         CDS       T04345                                 

Gene name
LOC109764751
Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats03030  DNA replication
ats03410  Base excision repair
ats03420  Nucleotide excision repair
ats03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ats00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109764751 (LOC109764751)
   03410 Base excision repair
    109764751 (LOC109764751)
   03420 Nucleotide excision repair
    109764751 (LOC109764751)
   03430 Mismatch repair
    109764751 (LOC109764751)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ats03032]
    109764751 (LOC109764751)
   03400 DNA repair and recombination proteins [BR:ats03400]
    109764751 (LOC109764751)
Enzymes [BR:ats01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109764751 (LOC109764751)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109764751 (LOC109764751)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109764751 (LOC109764751)
DNA replication proteins [BR:ats03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109764751 (LOC109764751)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109764751 (LOC109764751)
DNA repair and recombination proteins [BR:ats03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109764751 (LOC109764751)
   NER (nucleotide excision repair)
    Other NER factors
     109764751 (LOC109764751)
   MMR (mismatch excision repair)
    Other MMR factors
     109764751 (LOC109764751)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-ProteinID: XP_020179121
LinkDB All DBs
Position
Unknown
AA seq 1397 aa AA seqDB search
MASLLCSPASKSLSVTTSTLFLSSLASLTPAHTHPLSASAATPPVPASVPPTGLIPNSRF
LVDAFRHAGDFSVAYFLSHFHSDHYAGLGPSWRRGLVFCTAPTARLLASVLSVPPELIVS
IDIDVRITVDGWSVVAVDANHCPGAVQFLFTSPGPNPERYVHTGDFRYTHSMRSNPNLLE
FVGADALFLDTTYCNPKFTFPSQEESLEYVVNTIKQVKEESGAAGERVLCLIATYVVGKE
RILLEVARRCRCMIHVDSRKMEILTVLGFGGEKGVFTEDASATDVHVIGWNILGETWPYF
RPNFVKMKEIMVERGYTKAVGFVPTGWMYETKKEGFAVRVKDSLKIHLVPYSEHSSYDEL
RDYVKFLHPKRVIPTVGVDGGKLDGKEAIALQKHFVGLVDETANKHEFLMAFNRRSAHAS
LSHEDVLAKCCREQDGEEFALPENNSVSELPDNSEIKITEGMKKELSDFLPSWVNQDQIQ
GLLMSSGGDVVQSASAFFERERDFFEEANVSNNEKPKSVEIRTSDHGSSADTSSQQEVPS
FSQKPMEHSAKLVNLTPVRMNSNQTKKERKRGSSTVNKSKKKGKSTASTEAGGRKQPTIT
NYFGRAPAAASKSESANKVTVDPHQNNGENNNQSMDIVESHKQGVDQLLQIVDGSMSRES
AISLLEKTKGDVNVAVDMFYSKIQNNNVPDSDKSIVPQNTQNEMIDKYDNTNMVHNSSQA
TPKMQNLYVQTSVAQADSMNISLPVEKYLPIEHACWTAGHPAPYLHLARTFDLVEREKGK
IKTTAMLCNMFRSLLALSPDDVLPAVYLCTNKISPDHENMELNIGGSLVISAMEESLGTS
KSKIHEMYKTYGDLGDVAQECRQNQTLLAPPRPLSVRDVYSTLRKLSAISGGGSAGRRKI
LVLHLIRSCREMEMKFLVRTLVRNLRIGAMMKTILPALAHAVVLHEKCSTGPVVSLEGVK
SQLQSLSTEVTEAYNVIPNMDLLVPSLLCEGATFAASSLAMVPGTPIPPMLARITNGVTQ
ALKLFHGRAFTCEYKYDGQRAQIHRLTDGSVQIFSRQMKDSTSRFPDLVNMIKELCNSEV
ASFILDAEVVGIDRNKGNRLMSFQELSSRERGSKNSSIAIQNIKVDICVFVFDIMFCNGQ
RLLDNPLRQRRSYIHDLFQEKPGYLELAQQLTVEEDEASIDNSSTLHRMSSFFEKACQSS
CEGIMLKTLDIDAGYSASKRCDSWLKVKRDYVEGLGDSLDLVPIGAWYGNGRKAGWYSPF
LMACYNPESEEFQSVCRVMSGFSDDFYKEMKEFYSGEKILPKKPVYYKTDEQPELWFTAE
QVWEIRGADLTLSPVHHAAIGIVHPSRGISVRMPRHIRCVPDRSPEDCSTATDVASMFRA
QTRKMEVSSDGPGASHQ
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctcctctgctcccccgcctcaaaatcgctctccgtcaccacctccacactc
ttcctctcctcgctcgcgtcgctcacccccgcccacacccaccccctctccgcctccgcc
gccaccccgcccgtcccggcctccgtgccacccaccggcctcatccccaactcccgcttc
ctcgtcgacgccttccgccacgccggcgacttctccgtcgcctacttcctctcccacttc
cactccgaccactacgccggcctcgggccctcctggcgccgtggcctcgttttctgcacc
gctcccaccgcccgcctcctcgcctccgtgctctctgtgccgccggagctcatcgtctcc
attgacattgacgtccgcatcaccgttgatggctggagcgttgttgccgtcgatgccaac
cactgtcctggggccgtccagttcctcttcacctcccctggaccaaacccggagaggtat
gtgcacaccggcgacttccgatacacgcactccatgagaagcaaccctaatctgctggaa
ttcgtcggtgctgatgcgttattcctggacaccacatactgtaaccccaaatttacattt
ccttctcaagaggagtcactggagtatgttgtcaacacgataaagcaggtgaaggaggag
agtggggcggctggagagcgcgtcttgtgtttgatcgctacttatgttgtgggcaaagag
aggattctgctggaggttgcaaggcgctgccggtgcatgattcatgtggatagtaggaag
atggagattttgacagtattggggtttggtggggagaagggagtttttactgaagacgct
tcagcaacagatgtgcatgtcatagggtggaatattttgggggagacatggccctatttt
cggccgaattttgtgaaaatgaaggagatcatggtggagagagggtacaccaaggcagtt
gggtttgtaccaaccggatggatgtacgagaccaagaaggaagggttcgcagttagagtg
aaggattcactcaagatacatcttgtaccttatagtgagcactcgagctatgatgagctg
cgggactatgtgaagttcttgcacccaaaacgggtaattcccactgtgggagtagatggt
gggaagcttgatggtaaggaggcaattgctttacagaaacattttgttggattggtggat
gagacagcaaacaaacacgagttcctgatggcattcaatcgaagatcggcacatgcttct
cttagccatgaggatgtgttggctaaatgctgtagagaacaagatggggaggagtttgct
ttaccagaaaacaattctgtttctgaactaccagacaattcggagattaagattacagaa
ggaatgaagaaagaactgtcagatttcctaccctcatgggtcaaccaggaccagattcag
ggcctgttgatgagctcaggtggtgatgttgttcaatcagcatctgccttctttgagcgg
gaaagagatttctttgaagaagcaaatgtttctaataatgaaaagcctaagtcagtggaa
attcgtacttctgatcatggatcttctgctgacacaagtagtcagcaggaagttccttcg
ttttcacagaagcccatggagcattctgccaagctggtaaacttgactcctgtgagaatg
aactcgaatcaaactaagaaggaaagaaagaggggttctagtactgtaaacaagtcaaaa
aagaaaggaaaatcaactgcctcaacagaagctggtggacgcaagcaacccacaatcaca
aactattttggtagagcaccggcagctgcttctaaaagtgagtcagccaataaagtaaca
gttgatccacatcaaaacaatggggagaataacaaccagtcaatggacattgtggaatca
cacaagcagggagtagaccagcttcttcagattgtagatggcagcatgtccagagaatct
gcaatttccttgcttgagaagacaaaaggagatgtgaatgtagcagttgacatgttttac
agtaaaatccaaaacaataatgtacctgacagtgacaagagtattgtgccgcagaataca
caaaatgagatgatagataaatatgataacacaaacatggtccacaactcttctcaggct
actccaaagatgcaaaacttgtatgtacaaacttctgtagcacaagcagattcgatgaat
atatcattgccagttgaaaagtatctgccgattgagcatgcttgctggacagcaggacac
cctgcgccatacttgcatttagctcgcacttttgatcttgtagaaagagaaaaagggaag
atcaaaactactgccatgctttgcaacatgttcaggagtttgcttgccttatcacctgat
gatgtgctacctgctgtttatctatgtactaacaaaatttctccagaccatgaaaatatg
gaactaaacattggcggcagtctagttatatctgctatggaggagtcgctaggaacgagc
aaatctaaaatacacgagatgtacaaaacttacggtgatcttggtgatgttgcccaagaa
tgccgtcagaatcaaacactacttgctcctcctcgtccactctcagttcgggatgtatat
tctacactacgaaagctaagtgcaatatcaggtggtgggagtgctgggaggagaaaaatt
cttgtgttgcatcttattcggtcttgcagagaaatggaaatgaaatttcttgttagaacg
ctggtccgtaacttgcgtattggcgctatgatgaagacaatcttacccgctcttgcacat
gccgttgttcttcatgaaaaatgttcaacaggtcctgtggtatccttggagggtgtaaaa
tcacaattgcagagcctttcaactgaagttactgaggcatacaatgtcattcctaatatg
gatttgctcgttccctctcttctctgtgaaggcgctacatttgcagcttcgtccttagca
atggtacctggcacacctataccacctatgcttgcaagaattactaatggggtcactcaa
gcactgaagttgtttcatggtagagcatttacttgtgagtacaagtatgatggtcagcgc
gcccagattcacagattaactgatggatctgtgcaaatattttcaaggcaaatgaaagat
tcgacttcccgatttcccgatttagttaacatgatcaaagagctttgcaactcagaggtg
gccagctttatactggatgctgaagttgtgggaatcgataggaataaaggaaacaggctg
atgtcattccaagaattgtcttcaagagaaagagggagcaagaactcctcaattgcaatt
cagaacataaaggttgacatctgtgtgtttgtttttgatattatgttctgcaatggacaa
aggctattggataacccacttcgtcaaaggagaagctacatccatgaccttttccaggag
aagccaggatacttggagctagctcagcagttaactgttgaagaagatgaagcatcgata
gataattctagcactttacacagaatgagcagtttttttgaaaaagcatgccagtcttct
tgtgagggtataatgttgaagactcttgatattgatgctggatactctgcttccaagcgc
tgtgattcatggttaaaggtgaagcgtgactatgtggaaggcctaggtgatagccttgac
ttagttccaatcggtgcatggtatggaaatggacggaaagctggatggtacagccctttt
ctgatggcatgctacaaccctgaatctgaagaatttcaaagtgtctgtcgtgttatgtct
ggtttctcagatgatttctataaggagatgaaggagttttattctggtgaaaagatactg
cccaagaaacccgtgtactacaaaacagatgagcagccggagttgtggttcactgctgaa
caagtatgggagatccgaggtgcagatctcacactatcccctgtccatcacgcggccatc
ggtatcgtgcatccatcgcgcgggatttcagtgaggatgccgaggcacatacggtgcgtt
ccagatcggagcccagaggattgcagcacggccaccgacgttgctagcatgttcagagcc
caaacgaggaagatggaggtcagcagcgatggcccgggtgcaagtcaccagtga

DBGET integrated database retrieval system