KEGG   Aegilops tauschii (wheat D): 109767917Help
Entry
109767917         CDS       T04345                                 

Gene name
LOC109767917
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00564  Glycerophospholipid metabolism
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109767917 (LOC109767917)
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     109767917 (LOC109767917)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 Pyr_redox GIDA NAD_binding_8 Lycopene_cycl HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: XP_020182249
LinkDB All DBs
Position
Unknown
AA seq 632 aa AA seqDB search
MAAWRLRGAGTALAATSALAAAAAAWPSPASASDPSPAALESARQLVSRAGSGGGPPPRA
AQQAALAGSTAAEPLDVLVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALKERKQVIENAPHLCHALPCMTPCFNWFEVVYYWF
GLKFYDIVAGKRLLHLSRYYSVEESVALFPTLARNDGDRSLRGTVVYYDGQMNDSRLNVG
LACTSAVVGAAVLNYAEVVSLIKDESGERVIGARIRDTLSGKEFDAFAKVVVNASGAFCD
SVRKMANNDVVPMIAPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTT
DSSTAITMLPEPHEDEIQFILDAICDYLNVQVRRSDVLSAWSGIRPLAMDPSAKNTESIS
RDHVVFEDYPGLITITGGKWTTYRSMAEDAVNAAIRSGNLKPANGCVTDHLHIVGAYGWD
PASFTVLAQNYKRMKKTYGGKVIPGAMDSAVSKHLSHAYGTLAERVAAIAQNEGLGKRLA
HGYPFLEAEVAYCARHEYCESAVDFVARRCRLAFLDTDAAGRALPRIIEILASEHKWDKA
RRKLEQQKGIEFLETFKSSKNAQFRDGKHNGQ
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtggcgcctccgcggcgccggcacggccctggccgccacctccgcgctggcc
gcggccgcggccgcctggccgtcgccggcgtccgcctcggacccgtcccccgcggccctc
gagtccgcgcggcagctcgtgtcgcgggccggctcggggggcggcccgcccccgcgcgcc
gcgcagcaggcggcgctggccgggtccacggccgcggagccgctcgacgtgctggtggtc
ggcggcggtgccaccggctgcggcgtcgcgctcgacgccgccacccgcggcctccgcgtc
ggcctcgtcgagcgcgaggacttctcctccggcacctcctcccgatccaccaagctcatc
cacggcggtgtgcgttacttggagaaggcagtgttcaatcttgattatgggcagcttaaa
ctggtttttcatgctcttaaggagcgcaagcaagttattgagaatgctccccatttatgt
catgctttgccatgcatgactccttgttttaactggtttgaggttgtatactactggttt
ggtttgaagttctatgatattgtcgctggcaaaaggctgctacatttatcacggtattat
tctgtagaagaatcagttgcacttttcccgacccttgcaaggaatgatggtgaccgtagc
ctacgaggaaccgtggtttactatgatggtcaaatgaacgactctcgtttgaatgtgggg
ttggcatgcacatctgcagttgttggtgcagctgttctgaattatgctgaagtggtctcc
ctcattaaggatgaatcaggagagagggtcattggtgcacgcatccgtgacacgctatca
ggcaaggaattcgatgcatttgcaaaggtggttgttaatgcatcaggagcattctgtgat
tctgtaaggaagatggctaacaatgacgtagtacccatgatcgctccgagcagtggggtg
cacattgtacttcctgattattattcacctgaagggatgggtttaattgtccccaagacc
aaagatggtagagttgtattcatgctgccatggttgggaaggacggttgctgggacaact
gattctagtacagcaataacaatgcttcctgaaccacatgaagatgaaatacagttcata
ttggatgcaatatgtgattatcttaatgttcaggtgaggcgttcggatgttctttctgca
tggagtggtattcgcccattggccatggatccatcagcaaagaacacggaaagtatttct
agagatcatgttgtatttgaagactacccagggctaataacaatcacaggtggaaaatgg
acaacgtatagaagcatggctgaagatgctgttaatgcagcaatacggtcagggaatttg
aagccagcaaatggctgtgtgactgatcatttgcatatagttggggcatatggatgggat
cctgcttcttttactgtgcttgctcagaattataagcgaatgaagaagacatatggtggc
aaagttattccaggcgcaatggacagtgctgtatcaaaacatctgtcacatgcatatgga
actttggctgaaagagtggctgcaattgcccagaatgaaggcttgggaaagcgacttgct
cacggatacccattcttagaagctgaggtagcatattgtgctcgccacgagtactgcgag
tctgcggttgactttgttgcaaggagatgtcggcttgcctttcttgacacagatgctgca
gggagggcattaccccggatcattgagatcttagcttcggagcacaagtgggacaaggca
aggcggaaacttgaacagcagaagggtatagaattcttggaaaccttcaagtcatcgaag
aatgcacagtttagagatgggaaacataacgggcaatga

DBGET integrated database retrieval system