KEGG   Aegilops tauschii (wheat D): 109769383Help
Entry
109769383         CDS       T04345                                 

Gene name
LOC109769383
Definition
(RefSeq) cyclin-B2-1-like
  KO
K21777  G2/mitotic-specific cyclin-B, other
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ats03032]
    109769383 (LOC109769383)
   03036 Chromosome and associated proteins [BR:ats03036]
    109769383 (LOC109769383)
DNA replication proteins [BR:ats03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109769383 (LOC109769383)
Chromosome and associated proteins [BR:ats03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109769383 (LOC109769383)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C DUF4502
Motif
Other DBs
NCBI-ProteinID: XP_020183720
LinkDB All DBs
Position
Unknown
AA seq 408 aa AA seqDB search
MERAGENRRPVLAKPVPSVREMGNRRPLKELNNLAGAHPYPCAVAKKPMLEKSRRDEQKP
ALVTHRPMTRKLALLLENREQLDHLATAADAAKPGVDPQDEPIPNDTADTDEEIESVDDD
TDMDEDEQEDIVDDVSLMDIDSADSGNPLAATEYVDEIYRFYRENEKMSCVRPDYMSSQE
DINEKMRAILIDWLIEVHYKFELMDETLFLTVNIIDRYLEKQVVPRKKLQLVGVTAMLLA
CKYEEVSVPVVEDLVLISDRAYTKGQILEMEKSVLNTLEYNMSVPTPYVFMRRFLKAADS
DKQLQLVSFFMLELCLVEYQMLKYCPSLLAAAAVYTAQCAINRCWQWTKICETHSRYTRD
QLIECSKMMVQFHQKAAGGKLTGVHRKYSAFKFGCVAKVEPAHFLLGG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggagagggccggggagaacaggaggccggtgttggcgaagcccgtgccaagcgtccga
gagatggggaatcggaggccgctcaaggaactcaacaacctcgcgggggctcacccgtac
ccctgcgccgtcgccaagaagccgatgctagagaagagtcggagggatgagcagaagcca
gcattggtgacgcatcgtcctatgacgaggaaactcgccctcttattggagaacagagaa
caacttgaccatctggctaccgcagctgatgcagcaaaacccggagttgatccccaggat
gagcccatccccaacgacaccgctgacactgatgaagagatcgagtcggtcgacgacgat
actgacatggatgaggacgaacaggaggatattgtggatgatgtatccctcatggacatc
gacagcgccgactccgggaatccgctggccgcaactgagtacgtcgacgagatttacagg
ttctacagagaaaatgagaaaatgagctgtgtgcgtcctgattacatgtccagtcaagaa
gacataaatgaaaagatgagagctattctgatagattggctcattgaggttcattacaag
tttgagttgatggatgagacactctttcttaccgtgaacataatagacagatacttggaa
aaacaagtggtgccaaggaagaagttgcagttagttggagtgacagctatgcttcttgct
tgtaaatatgaggaagtctcagttccggttgttgaagatttagtgctcatttctgaccga
gcttacactaaaggacagattcttgaaatggaaaagtcggtcctaaacactctggaatac
aacatgtctgtaccaacgccatatgtttttatgagaaggttcctgaaggcagctgattct
gacaagcagctacagctagtttctttcttcatgcttgagctctgcctggttgaataccaa
atgctcaagtactgcccttcgctgcttgctgccgctgcagtttacactgcacagtgtgct
atcaatcgctgctggcagtggacaaagatctgtgagacacatagcagatacactagagat
cagctcattgagtgctccaaaatgatggtacaattccaccagaaggccgcaggggggaag
cttacaggcgtccacaggaaatacagtgcattcaagtttggttgtgtggcgaaagtggag
cctgcgcacttcttgctggggggatga

DBGET integrated database retrieval system