KEGG   Aegilops tauschii (wheat D): 109769894Help
Entry
109769894         CDS       T04345                                 

Gene name
LOC109769894
Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00052  Galactose metabolism
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109769894 (LOC109769894)
   00500 Starch and sucrose metabolism
    109769894 (LOC109769894)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109769894 (LOC109769894)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-ProteinID: XP_020184188
LinkDB All DBs
Position
Unknown
AA seq 866 aa AA seqDB search
MTIISSFADLFTLLTILICLLHRCGANYEVESVTGSGNVLSAKLKLVGGKAEFGPDVKRL
NLTASLETDNRLHVRITDADRSRWEVPQDVIPRPVPASEDVLLHSSGLSNSSLPGNSTMS
STSSDLTFTIHTAPFRFTVSRRSTGHVLFDTCAALIFKNRYLEVTSALPNRGASLYGLGE
QTKRRFRLQQNDTFTIWNEDVGRADILDINLYSSHPFYMDVRPGGTAHGVLLLNTNGMDI
KYGGSYITYKVIGGVFDFYFFAGPSPLTVVDQYTQLIGRPAPMPYWSFGFHQSRYGYKNV
ADLEGVVAGYTKAKIPLESIWSDIDYMDGGQDFTLDPINFPANLLRPFVDRLHNNSQKYV
VIIDPAIKKEAAPPQNESVGLFLQRNGTNYVGRVWPGEAYYPDFMSPHAAEYWARKISEF
RRTIPADGLWCDMNEPSNFKDWEPLNEYDDSPYRINNTGIHRNLNNKTVPVSAVHFNGVS
EYDAHNLYGLLESRATHDALLKDTARRPFVLSRATFVSSGRYTAHWTGDNDGRWEQLAQS
INTILNFGLFGIPMMGADICGFTGNTTEELCSRWIQLGAFYPFARAHAEKTTARRELYVW
ESTAQSARKALGMRYRLLPYIYTLMYEAHTTGSPIARPLFFSYPQDADTYGVDKQFLLGH
GVLVSPVLEPGATTVDAYFPAGRWFSLHGRSPAISLQTGKRVTLPAPADSANVHLAGGNI
LPLQQPGLTTSAARQSEFHLLVALAENGTASGELFLDDGESPEMGGVGGNWTLVRFSCNT
EDRKGIITTTVSSHVVQNSYAPSRTLVISKVAFMGLPSPPKGFTVDVNGAELKAAGTKSR
RNGVFTVSGLSLVIGQQFEIKVVTSH
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcatctcgtcatttgctgatcttttcacactcctcaccatcctcatctgcctc
ctccatcgttgtggcgccaactatgaagtcgagtcggtcaccgggtcggggaatgtgctg
tcagccaagctgaaacttgtaggcgggaaggccgagttcgggcctgatgtcaagcggctc
aatctgactgcaagcctagagacggacaaccggctccacgtgcgcatcaccgatgccgac
cgttcgcgatgggaggtcccccaggacgttatcccgcgcccagtgccggcgtcggaggac
gtcttgctacattcctcgggcttgagcaattcttccttgcccggcaacagtactatgtcc
agcacgtcttcagacctgaccttcaccatccacaccgccccgttccgcttcaccgtctcc
cgccgctccaccggccacgtcctcttcgacacctgcgccgccctcatcttcaagaaccgg
tacctggaggtgacgtccgcgctgccaaacaggggggcatctttgtacggactgggcgag
cagacaaaacggagatttcggctccaacagaacgacacgttcacgatctggaatgaggac
gtggggagggccgacatactggacatcaacctctacagctcacacccattctacatggat
gtgcgccccggcggcactgcgcacggcgttctgctcctcaacaccaacgggatggacata
aagtacggcgggtcctacatcacctacaaggtgatcggcggcgtgttcgacttctacttc
ttcgccggcccctccccgctcaccgtcgtcgaccagtacacccagctcatcggtcgccct
gcccccatgccgtactggtcattcgggttccaccagtccaggtatggctacaagaatgtg
gctgacctggagggcgtggtcgcgggctacaccaaggccaagattccattagagtcgatt
tggtcggacatcgactacatggacggcggccaggatttcacgctggatccgatcaacttc
ccggccaatctgctccggccgtttgtggaccggctgcacaataacagccagaaatacgtg
gtcatcatagacccggcgatcaaaaaagaagcagcgcctccgcaaaatgagtcggtgggt
ctgttcctccagcgaaatggcaccaactatgtcggccgggtgtggccaggcgaggcctat
tacccggacttcatgagcccacacgctgctgagtactgggcgcgcaagatctcggagttc
cgtcgaaccatccccgccgacgggctgtggtgcgacatgaacgagccctccaacttcaag
gactgggagccgctcaacgagtacgatgactctccctaccgcatcaacaacactggcatt
caccgtaaccttaataacaagaccgtgccggtctccgcggtgcacttcaatggtgtgtcg
gagtacgatgcgcacaacctctacggcctcctcgagtcgcgggccacgcatgatgctctt
ctcaaggacacggcgcgccgccccttcgtgctcagtcgcgccacgttcgtcagctcgggg
cgctacaccgctcactggaccggcgacaatgacggacggtgggaacagcttgcgcagtcc
atcaacaccatcctcaactttggactcttcggcatccccatgatgggcgccgacatctgc
ggcttcaccggcaacacaaccgaggagctctgcagccgctggatacagcttggtgcattc
tacccgtttgccagggcgcatgcagagaagacaactgcccggcgagagctctacgtgtgg
gagtcgacggcacagtcggcgaggaaggcgttggggatgcggtaccggctgctcccctac
atctacacgctcatgtatgaggcgcacacaacggggtcacccatagcgcgcccgctcttc
ttctcctatcctcaggatgccgacacctacggcgtggacaagcagttcctgctaggccat
ggcgtgcttgtctctccggtgttagagccaggcgctaccaccgtcgatgcctatttcccg
gccggccggtggtttagtcttcacggccgctcccccgccatctccttgcagaccggcaag
cgagtgacgctcccagcgccagcggactcggcaaacgtgcacttggccggcggcaacata
ctaccactgcagcagccaggccttaccacgtccgccgcacgccaaagcgagttccacctc
cttgtggccctcgcggagaatggtactgccagcggggagctgttcttggatgacggcgag
tcgccggagatgggaggggtgggaggcaactggacgctggtgaggtttagctgcaacacg
gaggatagaaagggcatcatcacgaccacagtgagttcgcatgtggtgcagaactcgtat
gcaccgagccggactctggtcatcagcaaggtggccttcatggggctcccgtcaccacca
aagggcttcaccgtcgatgtgaacggcgctgagctcaaggcagccggcaccaagtcccgg
aggaatggagtgttcaccgtcagtgggctgtcgctggtcatcggacagcagttcgagatc
aaggtcgtcacgtcccattaa

DBGET integrated database retrieval system