KEGG   Aegilops tauschii (wheat D): 109771024Help
Entry
109771024         CDS       T04345                                 

Gene name
LOC109771024
Definition
(RefSeq) fanconi-associated nuclease 1 homolog isoform X1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ats03400]
    109771024 (LOC109771024)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     109771024 (LOC109771024)
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     109771024 (LOC109771024)
DNA repair and recombination proteins [BR:ats03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     109771024 (LOC109771024)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC HIRAN
Motif
Other DBs
NCBI-ProteinID: XP_020185330
LinkDB All DBs
Position
Unknown
AA seq 977 aa AA seqDB search
MAPSRPPTALAGAMLTGRESLARLIGRRRRSPLPAPLAAALLSPSHSTPHQADDAGAGEA
AAAGPSSSGGGAGAERVACPVCGEFIPGSDYCVNTHLDICLSRGAKRKLTQSSLLDFRFS
KKTTAEPTPDILNNSDEAENKGLTDGDVSTDREFSSMNGVTGSPKDSGTTSLTGCLHGSP
GISKTLNTCIPSNAGLPIIKNAENDDAVEKASSCLLSAGTTSVSIDACPDADSSTTVAVD
TVIVGRRFRESFELQEGMGITVVRDPQNAKDPDAVKVLYAGSDCGQMLGYLPRELAKVLA
PLLDTHFMECEGFVAGLPEQQLDNVPIQLTCQKCENDNQNYEDLRYQQSLWENFLGVVRN
GNFQQPSGARYQANFNTMLLDVMTNHTHLFSDTETSFLGSFKSLSNDGQRLLVKIYTRKG
PWFRLSSISYCEISDVEHAAMELKLAGYIDMFSGTDVPFEHDMKEILNVLSVPEMKEILK
ELPKDNTNCTRRHELLSTLLSMHNNGTCTVLPKRIFKWTGTCIRVSNMADELLWLVQRLF
FLNGDQDLSSFLLVDLGLVKFPDYTCSVVHRIFQERNDLLQYEEAIRVAQFMDESLDNDN
MELVSRCTDLSENRLCTSLKEEDSSLADSPPSFYSCFSSTWIYSKILTLGVSVYERERRY
ADAIRTLKILLSKVASGRRRGYWTLRLSIDLEHMGRPNESLSIAEGGVTDPWIRAGSKIA
LQKRALRLGKPPRRWKVPSYADSLKRNIKEVNIEGRPLNCEIGAKNVFYGYDGDRCGVEQ
LALQYYADEGGGWQGTHSEGGIWMTIFGLLMWDVIFSEVCDVFHSKFQTAPLDFETDDFY
KSRKDLIEAQLKRIQDGMAEEMLISSWELHQGTSCKGVNWDRHPMADVRAVVAGVGGHRL
ALLLRHLALDYRSWSSGMPDLLLWHFLDERGGAEAKLVEVKGPKDQLSEQQRAWIFVLMD
FGFDVEVCKVSLVSKRR
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggccccgtcccggccgccgacggcgctggcgggggctatgctgaccggcagggagagc
ctggcccgcctcatcggccgccgccgccgctcccctctccccgcccccctcgccgccgcg
ctcctctccccctcccactccaccccccaccaggccgacgacgcgggcgcgggcgaggcg
gccgctgcgggcccttcttcgtcgggagggggcgccggcgcggagcgggtggcctgcccc
gtctgcggcgagttcatccccggctcggactactgcgtcaacacccacctcgatatatgc
ctctccagaggagcgaaacggaagttaacacagagcagccttctcgatttcagattcagc
aaaaaaacaacagctgagcctactccagacattttgaacaacagtgacgaggcagaaaac
aagggactgacggatggagacgtatctaccgacagagaattttcctccatgaatggcgtc
actggaagtcccaaggatagcggaaccacttcattaactggttgtctgcatggttcgcct
ggcatttctaagacgctcaatacatgtataccttcaaatgctggcttgccaattataaag
aatgctgaaaatgatgatgcagtcgagaaggcctcttcctgtttgctttcagcaggaaca
acttctgtcagtatcgatgcatgtccagacgcagattctagcaccacggtagctgttgat
actgtcatagtgggccggaggttccgtgaaagctttgaactgcaagaaggcatgggcatt
actgttgtaagagacccccagaatgccaaggaccctgatgctgtcaaggtgctttatgca
gggtctgactgtgggcagatgcttggatatctgcctcgagagctggctaaagtcttggct
cctctactggacacacatttcatggaatgcgagggatttgtggctggtttgcctgaacaa
cagcttgacaatgtgcccatccagctaacttgtcagaaatgtgaaaatgacaatcagaat
tatgaagatctgagataccaacaatccttgtgggaaaattttcttggtgttgttagaaat
ggaaatttccagcaacctagcggtgcaagataccaggcaaatttcaatacgatgctattg
gatgttatgaccaaccatacacaccttttcagtgatacggaaacatcatttttaggatct
tttaagtcgttatcgaatgatggccaaaggcttttagtgaagatttacactcgaaaaggg
ccatggtttaggttgagcagcatttcgtattgtgagatatcagatgttgagcatgcagcc
atggagttgaagttggcaggttacatagacatgttttctggcaccgatgttccatttgaa
catgatatgaaagagattctcaatgtgctaagtgttcctgaaatgaaggaaatcctaaag
gagctccctaaggataacacaaactgcacccgtcgacatgagcttcttagcacccttctc
tctatgcacaataatggaacctgcacagtgctaccaaagcgaatttttaaatggacagga
acctgtataagagtctccaatatggctgatgaacttctctggcttgttcagaggctattt
tttctaaatggtgatcaagatctttcatcctttctattagtggatcttggtctggtgaaa
ttcccagactacacatgcagcgttgttcatcgtatttttcaagaaagaaatgatttactt
cagtatgaagaggcaattcgagtggcacagttcatggatgaatctcttgataacgataac
atggaattagtgtcaagatgcactgatttgtctgagaatcgactatgcacttcgttaaaa
gaagaagatagcagtttagctgattctcctccatcattctattcatgcttttcatctacc
tggatctattccaaaatactcacattaggtgtctctgtttacgaacgcgaacgcaggtat
gcagatgcaataaggactctaaagatactacttagtaaagttgcttctggtagacggcga
ggatattggacactgagattatctattgatttggagcatatgggtcgccctaatgagagc
ctttcaatagctgaaggaggagtgaccgacccatggatccgtgctgggtcaaagattgca
ctgcagaagagagctctgcgtttaggcaaacctccacggcgctggaaagttcccagttat
gctgattctcttaagagaaacataaaagaggtgaacatcgaaggaaggccattaaattgt
gaaataggagcaaagaatgtgttttatggctatgatggtgaccgttgtggggtagagcaa
ttagctttgcagtattatgctgatgagggaggtggctggcaaggtacccattcagaaggt
ggcatatggatgacaatctttggccttctaatgtgggatgtaatattctcagaagtatgc
gatgttttccattctaaatttcagacagcccctcttgattttgaaacagacgacttctac
aagtcaagaaaggaccttatagaagcacagttgaaaaggatacaagatggaatggccgaa
gagatgcttatcagctcctgggagctacatcaagggacatcctgcaagggtgtcaattgg
gaccggcatccaatggccgatgtacgggctgtcgttgcgggcgttggtgggcatcgcttg
gcactacttctccggcatctagccctcgattacaggagctggtccagcgggatgcccgat
ctgctgctatggcatttcctggatgaacgaggtggtgctgaagctaaacttgtggaggtc
aaaggaccaaaggatcagctctctgagcagcaacgggcttggattttcgtcctgatggat
tttgggtttgatgtggaagtttgcaaagtgagcctagtttctaagcggcgataa

DBGET integrated database retrieval system