KEGG   Aegilops tauschii (wheat D): 109774279Help
Entry
109774279         CDS       T04345                                 

Gene name
LOC109774279
Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH2-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109774279 (LOC109774279)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ats03036]
    109774279 (LOC109774279)
Enzymes [BR:ats01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109774279 (LOC109774279)
Chromosome and associated proteins [BR:ats03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109774279 (LOC109774279)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-ProteinID: XP_020188588
LinkDB All DBs
Position
Unknown
AA seq 675 aa AA seqDB search
MEVDESSPSSLLSSPSSLSSDSIDLNFLPFLRREPKSEPASPEHGPLPPPLPLPLPPQAT
AAIAVAFAAPTTPDLSSPEVLTPLQSLPPNPDEDALFAEYCRLASLYLLSAGAGAIVPAP
TPEAAAPAAVQPGSGSAAKKRRPRSSELVRVSSLSVRDQIYFRDLVRRARITFESLRGLL
LKDDERAEALGLAGVIGLGSVDRRRVRADLRAAALMADRDLWLNRDRRIVGPIPGIAVGD
AFFFRMELCVLGLHGQVQAGIDYLSAGQSASGEPIATSIIVSGGYEDDDDRGDVLVYTGH
GGRDPNLHKHCVDQKLEGGNLALERSMAYGIEIRVIRAVKSKRSPVGKVYFYDGLYKVVD
YWLDRGKAGFGVYKYKMIRIEGQEPMGSVNYRAAEHLKVDALSMRPTGYLSFDISMGREI
MPVALYNDVDDDRDPLLFEYLARPIFPSSAVQGKFAEGGGGCGCIENCSIGCYCAERNGG
EFAYDKAGVLLRGKPLLYECGPYCQCPPSCPNRVSQKGLKNRLEVFRSRETGWGVRSLDL
IKSGTFICEFSGIVLTHQQSEIVAASGDCLVHPNRFPSRWLDWGDISDVYPEYVAPNHPA
TTDLNFSIDVSRARNVACYFSHSCSPNVFIQFVLFDHYNVSYPHLMIFALENIPPLRELS
IDYGMIDEWVGKLTM
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggatgagtcctcgccgtcgtcgctgctgtcctcgccctcatctctttcctct
gactccattgacctcaacttcctgccgttcctgaggagggagcccaagtcggagccggct
tctcctgagcatggccctctgccgccaccgctgccgctgccgctgccgccgcaggccacg
gctgctattgcggtggcgttcgcggcaccgacaacgcctgacctgtcttcgcctgaggtc
ctgacgcctctgcagtcgctgccaccaaaccccgacgaggacgcgctcttcgcggagtac
tgccgattggcgagcctctacctgttatcagcgggggccggggcgatcgtgccagcgccg
acgcctgaggccgcggcgccggcggcagtgcagcctgggtcggggtccgcggcgaagaag
cgccggccgcggtcgtcagagttggtacgggtgtcctcacttagcgtgcgggatcagatc
tattttcgtgatttggtgcgccgggcgcgcatcaccttcgagtcgctccgcggcctgctg
ctgaaggacgacgagcgcgcggaggcgctcggtcttgcgggcgtcatcgggcttggctca
gtggaccggcgtcgcgtgcgcgccgacctgcgggctgcggcgctcatggccgaccgagac
ctgtggctcaaccgcgaccgccgcatagtggggccgatacctgggattgctgtcggcgat
gccttcttcttccgcatggagctatgtgtgctgggcctccatggccaggtgcaggccggg
attgattatctctcagcagggcaatctgcctcaggcgagcctatagccacatctattatt
gtctctggtgggtatgaagatgatgatgatcgtggtgatgtactggtgtacaccggccat
ggtggccgagaccccaacctgcacaagcattgcgtcgaccagaagcttgagggcggcaat
cttgccctcgagcgcagcatggcctatggtattgagattcgtgtaatccgtgctgtcaag
tctaagcgcagccctgttggaaaggtctacttctacgacggcctctacaaggttgttgac
tactggctcgatcgcgggaaagcaggctttggtgtttacaagtataaaatgattcgcatt
gaagggcaggagcccatgggatctgtgaattatcgcgcagctgaacatcttaaggtggat
gcactatctatgcgaccaactggatacctgagctttgatatttccatgggtcgagagatt
atgccagttgcactatataatgatgtcgatgatgatagggacccactcttatttgagtac
ctggcacggccaatattcccatcttctgcagttcaagggaagtttgctgagggtggtggt
gggtgtgggtgcatcgagaattgctcaattggatgttattgtgcagaaaggaatgggggt
gagtttgcgtatgataaagctggtgttcttctaaggggcaaaccactgctgtatgagtgt
ggtccatattgccaatgcccacctagctgccccaacagggttagtcagaaggggcttaag
aataggcttgaggtgttccggtcaagggaaactgggtggggtgttcggtctctggatctc
attaagtctggcacgttcatctgtgagtttagtgggattgtgcttactcatcagcagtca
gagatagtggcagccagtggtgattgtttggtgcatccgaacaggttcccttcaaggtgg
ttagattggggtgatatctctgatgtatatcctgagtatgtcgctccgaaccatcctgcc
actacagacttgaacttttcgattgatgtctcaagggcaaggaatgtggcttgttatttc
agccatagttgcagtccaaatgtatttattcagtttgtgctgtttgaccactacaacgtg
tcttatccccacctcatgatctttgccctggagaacattccgcccttgagggagctaagc
attgactatggaatgattgatgaatgggttggaaagttaactatgtag

DBGET integrated database retrieval system