KEGG   Aegilops tauschii (wheat D): 109781665Help
Entry
109781665         CDS       T04345                                 

Gene name
LOC109781665
Definition
(RefSeq) histone-lysine N-methyltransferase EZ1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109781665 (LOC109781665)
Enzymes [BR:ats01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109781665 (LOC109781665)
Chromosome and associated proteins [BR:ats03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109781665 (LOC109781665)
   Polycomb group proteins
    PRC2-EZH2 complex
     109781665 (LOC109781665)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-ProteinID: XP_020195844
LinkDB All DBs
Position
Unknown
AA seq 887 aa AA seqDB search
MSEEERSEASRHVLRVIDSLKKKVTADRFTYIKNRIEDNKIKLSPVTQGTGNSSKIWQRN
TSNSTDSNLLTSRQDDVLSSGPRIVVSPADEDGVSSDEESSYAASTVMLGGNLAAKNVTR
PIKLPEAPKIPPYTTWTFLDRNQRMTEDQSVLGRRRIYYDANCGEALICSDSEDEAVEDE
EEKKEFKVCEDCLIRMTIQECGMSDAVLETLARCFDRAAGDIKARYEILNGEKTEGSLKK
VSVPNAKVEDLYRDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQPPWNSLD
DGIPCGIHCYKLAPKPDATTTVDSDMLDIEEPTHSSDNTRNQLSSNKKKQGSSGKKAKSQ
QSEGSSTQRVASESSDSEGHPTSTKSPQQSSCQSKVKISPKGGIRKSTNRRIAERILMSV
KKGHREVAPSDSNSGGCLWPRDMKLRSDTRNGHKDSVASPQQNSPSTRSSRKKDAPQMEN
SLASGEDRNDSTEETKNEHSATDGHDSSMIEDVEENICRQENKCRSWKVIEQGLLVKGLE
IFGRNSCLIARNLLWGMKTCSDVFQYMSYIENSSASGTLSRGDSLVKGYIKGHELRVRSR
FIRRRGRVRRLKYTWKSAGYHFIRKRITERKDQPCRQYNPCGCQSSCGKQCPCLVNGTCC
EKYCGCPKMCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVGCGDGSLGVPSQ
RGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNTVSKHEYLGEYTGELISHKEADKR
GKIYDRENSSFLFNLNNEFVLDAFRMGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKE
RIGSGEEIFYDYRYEPDRAPVWARKPDAPGAKDPGQPSSGRAKKLAH
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagaagaaagaagtgaggcctcccgacacgttttacgtgttattgactcgttg
aagaagaaagttacagcagatcgttttacttacattaagaataggatagaggataacaag
ataaagctcagccccgttacacaaggcactggcaattcttcaaaaatctggcaaagaaat
acatcaaatagcactgactcgaatctgctgacaagtaggcaagacgatgtactctcttct
gggcctcgtattgtagtatcccctgctgacgaagatggtgtcagttctgatgaagaaagc
tcctatgccgcgtcaactgttatgttgggtggaaatctagctgcaaagaatgtcactagg
ccaattaaactaccagaagcaccaaaaattccgccttatacaacatggacatttttggac
aggaaccagaggatgacagaagaccaatctgtacttggtcgacgaaggatttactatgat
gcaaattgtggtgaagctttaatttgcagtgatagtgaggatgaagctgttgaggatgaa
gaggagaaaaaggagttcaaagtttgtgaagactgtcttattcggatgacaattcaagaa
tgtggcatgtctgatgcagtgctggaaaccctagctcgatgttttgatagggcagctggt
gatataaaggccagatatgagatcctaaatggggagaaaactgagggttctcttaaaaag
gtttctgtacctaatgccaaagtggaagatctctaccgtgataaagatttggatgcagca
ttggattcctttgacaatctcttttgtcgccgatgtctagtttttgattgcaaactacat
gggtgttctcaagatttagtatttcctacagaaaagcaaccaccttggaacagcctggat
gatggtataccatgtggtattcattgctataaactggctcctaaaccagatgctactacc
acagttgattctgacatgcttgacatagaggagccaactcactcatctgataatacaagg
aaccagttaagctcaaataagaaaaaacagggttctagtggtaagaaagcgaaatcccaa
caaagtgaaggctcttcaacccaaagggttgcctcagaaagcagcgactcagaaggacat
ccaacgagtactaaatctccacaacaatcatcttgtcaatcaaaagtcaaaattagccca
aaaggtggaatcaggaaaagtactaatagaagaattgccgagcggattcttatgagtgtg
aaaaaaggacatagagaagtggcaccatcagattctaattctggtggatgtctctggcca
agggacatgaagcttagatctgatacacgaaatgggcacaaggattcagttgcatcccca
caacagaattctccaagcacaagaagttctcggaagaaggatgcgcctcaaatggagaat
agtttagcttcaggggaagatcgtaatgattcaacagaggaaactaagaacgaacattca
gcaacagatggccatgatagttcgatgatagaagatgttgaggagaatatatgcaggcaa
gaaaataaatgtagatcctggaaggtgattgagcaagggcttctagtgaaaggtttggag
atttttggaaggaacagttgtttaattgctcggaaccttctctggggaatgaaaacatgc
agcgatgtttttcagtatatgagttatattgaaaacagcagcgcatctggaactcttagc
aggggtgattctctcgtcaaaggatatataaagggacatgagttgcgtgtgagatcacgg
tttattagaaggcgaggtagagttcgtcgtttgaagtacacctggaaatctgcaggctac
cattttataaggaaaaggattacagaaaggaaggatcagccttgtcggcaatataaccca
tgtggttgtcaatcatcatgtgggaaacagtgtccatgtcttgtaaatgggacatgctgt
gagaaatactgtgggtgtccgaaaatgtgcaagaatcgttttcgaggttgtcattgtgca
aagagccagtgtcgcagtcgccagtgtccatgctttgctgctgacagggaatgtgatcct
gacgtgtgcagaaactgctgggtagggtgtggtgatggttcattgggagttcccagccaa
agaggcgataattatgaatgccggaacatgaagctacttcttaaacaacaacaaagggtc
ttacttggaagatctgatgtttctggctggggagcatttctcaagaatactgttagcaag
catgaatatcttggcgagtacactggggagcttatctctcacaaggaagcagataagcgt
ggaaagatatatgaccgtgagaattcgtccttccttttcaacctgaataatgagtttgtt
ctggatgccttcagaatgggcgacaagctgaagtttgccaaccactcccccgacccgaat
tgttatgccaaggtcatcatggtagcaggcgatcacagggtgggcatatttgccaaagag
cggatcggttcaggagaggagatcttctatgattaccgctacgagcctgaccgagccccc
gtgtgggctcgaaagcccgatgcccctggagcgaaagaccccgggcagccttccagcggg
cgggccaagaagctcgcccattga

DBGET integrated database retrieval system