KEGG   Aegilops tauschii (wheat D): 109781800Help
Entry
109781800         CDS       T04345                                 

Gene name
LOC109781800
Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00010  Glycolysis / Gluconeogenesis
ats00051  Fructose and mannose metabolism
ats00052  Galactose metabolism
ats00500  Starch and sucrose metabolism
ats00520  Amino sugar and nucleotide sugar metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
ats01200  Carbon metabolism
Module
ats_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ats_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109781800 (LOC109781800)
   00051 Fructose and mannose metabolism
    109781800 (LOC109781800)
   00052 Galactose metabolism
    109781800 (LOC109781800)
   00500 Starch and sucrose metabolism
    109781800 (LOC109781800)
   00520 Amino sugar and nucleotide sugar metabolism
    109781800 (LOC109781800)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109781800 (LOC109781800)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ats04131]
    109781800 (LOC109781800)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109781800 (LOC109781800)
Membrane trafficking [BR:ats04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109781800 (LOC109781800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: XP_020195991
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MRKAAVAAVAAAAAVGVALLARRQMREAKRWGRADAVLRGLEERSAAPPARLRQVADAMA
VEMHAGLASEGGSKLGMIISYVDSLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVK
QECDEISIPAHLMTGTSQELFDFIAAALAKFVASEGEDFHLLEGRQRELGFTFSFPVKQS
SIASGTLIKWTKGFSIDETVGADVVAELSSALDRQGLDMKVTALVNDTIGTLAGGRYDDN
DVVAAVILGTGTNAAYVERANAIPKWHGLLPKSGDMVINMEWGNFRSSHLPLTEFDQALD
AESLNPGEQIYEKLISGMYLGEIVRRVLLKMTEEASLFGDDIPPKLKIPFILRTPHMSMM
HHDTSPDLRTVGAKLKDVLGIQGTSLKTRRLVVDVCDIVAKRGARLAAAGIHGVLKKLGR
DIPGSDKHRTVIAMDGGLYEHYTIFSETLENTLREMLGEEVSSSVVIKLANDGSGIGAAL
LAAAHSQYLEAEV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcggcggtggcggcggtcgcggcggcggcggcggtgggggtggcgctgctg
gcgcggcgccagatgcgggaggccaagcggtggggccgcgccgacgcggtgctgcggggc
ctcgaggagcgctccgccgcgccgccggcccggctgcgccaggtggccgacgccatggcc
gtcgagatgcacgccgggctcgcctccgagggcggcagcaagctcgggatgatcatcagc
tacgtcgactccctcccctcggggcaagagaaggggctattttatgcacttgaccttgga
gggacaaattttcgcgttttacgtgttcaattaggaggcaaggaagggcgagttgtgaag
caagaatgtgatgagatctcaatcccggcacacttaatgactgggacctcgcaagaacta
tttgattttattgccgctgctttggcaaaatttgttgcctcagagggtgaagactttcat
cttcttgagggaaggcaaagagagcttggttttactttctcttttccagtaaagcagtct
tcaattgcatccggaactcttatcaagtggactaagggtttttctattgatgaaacggta
ggcgcagatgtggtggctgaattaagcagtgctctagaccgtcaggggcttgatatgaaa
gtgacagcactggtaaatgatactataggaacattggctgggggcagatatgatgacaat
gatgtcgttgctgctgttattctgggtacaggtaccaatgcagcatacgtggaacgtgcc
aatgcaattcctaaatggcatggcctccttcccaagtcaggagatatggtaataaatatg
gaatgggggaacttcagatcgtcccatcttcctttgactgaatttgatcaagcattagat
gcagaaagcctgaatcctggtgaacagatttatgaaaagctgatctctggtatgtatttg
ggggaaattgtaagaagagtcttgttaaagatgactgaagaagcttctctttttggtgat
gatataccaccaaaactaaagatcccatttattcttaggacgccacatatgtcaatgatg
caccatgacacgtcacctgatctcagaacagttggagccaaactgaaagatgtcctaggg
atccagggcacctcacttaaaacgagacggctagttgtggacgtatgcgacatcgttgca
aagcgtggggcgcgccttgctgctgcagggatacacggggtcctcaaaaagcttggacgg
gacatccccggcagcgacaagcacaggacggttattgccatggacggtgggctctacgag
cactacacaatcttcagcgaaaccctggagaacaccctgcgcgagatgctaggggaggaa
gtatcctcctccgttgtcatcaagctcgcgaacgacgggtcaggtatcggggccgctctc
ctcgctgcagctcattctcagtacctcgaggccgaggtctga

DBGET integrated database retrieval system