KEGG   Aegilops tauschii (wheat D): 109783273Help
Entry
109783273         CDS       T04345                                 

Gene name
LOC109783273
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ats03009]
    109783273 (LOC109783273)
Enzymes [BR:ats01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109783273 (LOC109783273)
Ribosome biogenesis [BR:ats03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    109783273 (LOC109783273)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL Nucleoplasmin
Motif
Other DBs
NCBI-ProteinID: XP_020197474
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MSSFWGAEVKPEKPYTHTHSPRRGRLRLTQATLGAEVGKVEKGKTNLVQLQCTVKNKEPV
YLCALIPGQSVTCHLDLEFEEKFVTFSVLGSRSVHLAGYYVGDAYEDIGDSDTGSESLQG
SDDDFLASDDDDVVIPVSRGQMNTDSEDDSDYDEDYDSEDDEDLMYNQGRGKSSVVIEEI
QEDEKPVDDNSRLQLAVRTPPAESVESEDEDGFPVSESKKSSKGSSEKDKNLNNGTSTED
RKRKSDAINDPHKSSGEVNAENDVVSKKKKKAKDKRNAVDSEKVNDEEKEVKLASSADTI
AAKQKKKKSKKQSASEGDTDEQADKKTITDNDEEPSKQGAKKKKNKKKTKENNGSENQAQ
TDVMNSASKEQTSPKARTYGNGLIVQTVALGKPDGKKATPGKKVFVTYTGKLKNGKIFDS
NVGRKPFSFRLGVGQVIKGWDIGVNGMRIGDKRKLTIPPSMGYGNQKAGEIPPNSTLMFD
VELMNVQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgttttggggcgcggaggtgaagccggagaagccctacacgcacacccacagc
ccgcgccgcggccgcctgcgcctcacccaggcgacgctgggggccgaggttggcaaggtg
gagaaggggaagacgaacttggtgcagctgcaatgcactgttaagaacaaggagcctgtg
tatctctgcgccctgattccggggcagtcggtgacttgccacctggacctcgagttcgag
gagaagttcgtgacgttctcggtgcttgggtcgaggagcgtccacttggctggatactat
gttggtgatgcgtacgaggacatcggtgacagtgatactggtagtgagtcacttcaaggc
tccgatgatgatttcttggcatctgatgacgatgatgtggtcattccagtatcccgtggc
cagatgaacacagacagcgaagatgattcagactatgacgaggactatgattcagaggat
gatgaggatttgatgtacaaccagggtagaggcaagagttcagttgtcattgaggagatt
caagaggatgagaagcctgttgatgataattctcgacttcagcttgctgttaggacccca
cctgctgaatccgtggaaagtgaagatgaagatggctttcctgtttctgaatcaaagaag
agttctaaaggtagttccgagaaggataagaatctaaataatgggactagtactgaagac
aggaaaaggaaaagtgatgctattaatgatcctcacaagtcgtcaggggaggttaatgct
gaaaatgatgtggtttcaaagaaaaagaaaaaggccaaggacaaaaggaatgctgtggac
agtgagaaggtaaacgatgaagaaaaggaggtgaagctagcttcctcagctgacaccatt
gcagccaaacagaagaaaaagaaaagcaagaagcaaagtgcttctgaaggtgacactgat
gagcaagctgataagaaaaccataacagacaatgatgaggagcctagcaaacagggggcc
aagaaaaagaagaacaagaagaaaacaaaggagaacaatggaagtgagaaccaggcacag
actgatgttatgaattcagctagcaaggagcagacatcacccaaagcacggacttatggc
aatggtttgattgttcagacggtggcgttgggcaaaccagatggtaaaaaagctacccct
gggaaaaaggtttttgtcacgtacactggcaagttgaagaatggcaagatttttgactct
aatgttggtcggaagcctttttcgtttaggctgggtgttggacaggttattaaaggctgg
gacattggtgtcaatggtatgcgcattggggacaaaagaaagcttaccattccaccatct
atgggctatggaaaccagaaggccggggagataccgccgaactcaactcttatgtttgat
gtggagctaatgaacgtacagtga

DBGET integrated database retrieval system