KEGG   Aegilops tauschii (wheat D): 109784254Help
Entry
109784254         CDS       T04345                                 

Gene name
LOC109784254
Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00010  Glycolysis / Gluconeogenesis
ats00020  Citrate cycle (TCA cycle)
ats00620  Pyruvate metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
ats01200  Carbon metabolism
Module
ats_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109784254 (LOC109784254)
   00020 Citrate cycle (TCA cycle)
    109784254 (LOC109784254)
   00620 Pyruvate metabolism
    109784254 (LOC109784254)
Enzymes [BR:ats01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     109784254 (LOC109784254)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118
Motif
Other DBs
NCBI-ProteinID: XP_020198442
LinkDB All DBs
Position
Unknown
AA seq 474 aa AA seqDB search
MAASSAPLAFSASASALSARLRLAAPAASCAATTRRRRPVVVRAKIREIFMPALSSTMTE
GKIVSWAAAEGDRVAKGDAVVVVESDKADMDVETFYDGIVAVVLVPAGESAPVGAPIALL
AESEEDVALAVAQAQALSSGQPQQEAPALSDAAASPPPPAAPVAAAPAPVAAGTKGVATP
QAKKLAKQHRVDLAKVTGTGQFGRITPADVEAAAGIQPKPKVAPTPAAAAPVAAASSVRA
VPQAAVLPPVPGATVVPFTAMQAAVSKNMVESLSVPAFRVGYPILTDKLDALYEKVKPKG
VTMTVLLAKAAAMALAQHPVVNASCRDGTSFTYNSSINIAVAVSIDGGLITPVLEQADKL
DIYLLSQKWKELVKKARAKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGA
SKSTVAADKDGFFSVKSKMMVNVTADHRIVYGADLAAFLQTFAKIIEDPESLTL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatcctcggcccccctcgcgttctccgcctccgcctccgccctgtccgcgcgc
ctgcgcctcgccgctccggcggcgtcgtgcgcggccacgacgcggcgccgccgcccggtg
gtggtccgcgccaagatccgcgagatcttcatgccggcgctcagctccacgatgacggag
ggcaagatcgtgtcctgggccgccgcggagggcgaccgcgtcgccaagggcgacgccgtc
gtggtcgtcgagtccgacaaggccgacatggacgtcgagacgttctacgacggcatcgtc
gcggtcgtcctcgtccccgcgggcgagtccgcccccgtcggcgcccccatcgccctgctc
gccgagtctgaggaggacgtcgcgctcgccgtcgcccaggcccaggcgctctccagcgga
cagccccagcaggaggcccctgctctctcggacgccgccgcttcaccgcccccaccggcg
gctccggtggctgctgctcccgcgcctgtggctgcggggacgaagggcgttgccacgccg
caggctaagaagctagccaagcagcatagggtggaccttgccaaggtgaccggcaccggg
cagttcggccgaattacgccggctgatgttgaggcagccgctggcatccagccaaaacca
aaggtggctcctactcctgctgctgctgcgcctgtcgctgcagcttcgtcagtaagggct
gtgccgcaggcggccgtgcttccgccggtgcccggtgccacggtggttccattcactgcg
atgcaggctgcagtgagcaagaacatggtggagagcctgtcagtgccagcattccgtgtt
ggttaccccattctcactgataagctcgatgcgctgtatgagaaggtcaagccaaagggg
gtgacgatgaccgtgttgcttgcaaaggccgctgccatggcacttgcacagcaccctgtg
gtgaacgctagctgcagggacgggacgagcttcacttacaacagttccatcaatattgct
gtggctgtatctattgatggtggactcatcacacccgtcctggagcaagctgataagctg
gatatatatttactctcacaaaagtggaaggaactagtcaagaaggcacgcgcaaaacag
cttcaaccgaatgagtacaactctgggacatttacactgtccaacttgggcatgtttggt
gtagatagatttgatgcaattcttccacctggccagggagctataatggctgttggagcc
tcaaaatctacagtggcggctgataaagatggtttctttagtgttaagagcaaaatgatg
gtcaatgtcacagctgatcacaggattgtttatggtgctgatttggcggcattcctgcaa
acttttgcgaaaattattgaggatcctgagagcctaactttgtag

DBGET integrated database retrieval system