KEGG   Aegilops tauschii (wheat D): 109787002Help
Entry
109787002         CDS       T04345                                 

Gene name
LOC109787002
Definition
(RefSeq) 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform X1
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00071  Fatty acid degradation
ats00280  Valine, leucine and isoleucine degradation
ats00592  alpha-Linolenic acid metabolism
ats01040  Biosynthesis of unsaturated fatty acids
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
ats01212  Fatty acid metabolism
ats04146  Peroxisome
Module
ats_M00087  beta-Oxidation
ats_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109787002 (LOC109787002)
   00592 alpha-Linolenic acid metabolism
    109787002 (LOC109787002)
   01040 Biosynthesis of unsaturated fatty acids
    109787002 (LOC109787002)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109787002 (LOC109787002)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109787002 (LOC109787002)
Enzymes [BR:ats01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     109787002 (LOC109787002)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: XP_020201150
LinkDB All DBs
Position
Unknown
AA seq 461 aa AA seqDB search
MEKALDRQRILLRHLEPAAGASPTASAISASACAAGDSAAYHRGPCFTDDVVIVAAYRTA
ICKAKRGSFKDTLPEDLLVPVFKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL
YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGVESMTVNKVNLVEKANP
KVELFAQARDCLLPMGLTSENVAQRFGITRMEQDQAAVESHRKAAAAVAAGKFKEEIVPV
HTKIMDPKTGEEKEIVVSADDGIRSNTTLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV
LLMRRDVATQKGLPILGIYRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQINDIDLFEIN
EAFASQYVYCSKKLDLDPAKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGV
ISMCIGSGMGAAAVFERGDAVDELTNARGGPSLNWLSKDTV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggcgctcgacaggcagaggatcctgctgcggcacctggagcccgcggccggc
gccagcccgaccgcctccgccatctccgccagcgcgtgcgccgcaggggacagcgccgcg
taccaccggggcccctgcttcaccgacgacgtcgtcatcgtcgctgcctataggacagca
atctgcaaggccaagagaggtagtttcaaggatacactccctgaggacctcttggtaccg
gtattcaaggctttggtggataaaacaaagctaaatccgagcgaagttggcgacattgtt
gttggtactgttttagctcctgggtcccaaagggcaatagaatgcaggatggccgcattg
tatgcgggtttccctgacacggttcctctgaagactgtaaaccgacagtgctcttctggg
cttcaggcagtcgcagatgttgctgctgctattaaagcagggatgtatgatattggtatt
gctgctggcgtagagtcaatgacagtgaacaaagttaatcttgtcgagaaagcgaatccc
aaagttgagctatttgctcaagcacgcgattgccttctcccaatgggccttacctccgag
aatgttgcacagcggtttggcataacacgcatggagcaagatcaagctgctgttgagtct
cacaggaaggcagcggcggcagttgctgctggtaaatttaaagaagaaattgttccagtt
catacaaagatcatggatccaaaaactggtgaagaaaaggagattgtggtctcagcagat
gatggaatccggtcgaataccacactggcagtcctgtcaaaacttaaaccagcattttcc
aaggacgggacaactactgctggaaatgctagccaagtaagtgatggagctggagctgtc
ctactaatgaggcgagatgttgctacacagaagggtcttccaattcttggaatctacagg
agctttgctgcagttggagttgatccagctgtgatgggtgttggtcctgctgttgctatc
ccagcagcagtgaaggccgcgggccttcaaattaatgatattgaccttttcgagattaat
gaggcttttgcatctcagtatgtgtactgctcaaaaaagttggatctcgatcccgcaaaa
gtcaatgttaatggaggtgcaattgctcttggacatccattgggtgccacaggtgcgcgc
tgtgtcagcactcttctcaacgagatgaagcgccgaggcaaggactgccggtttggagtg
atttctatgtgcataggttccgggatgggtgcggccgccgttttcgagcgtggagatgcg
gtggatgagctgacgaatgcccgaggggggccctcgcttaactggctctccaaagacacc
gtgtaa

DBGET integrated database retrieval system