KEGG   Aegilops tauschii (wheat D): 109787299Help
Entry
109787299         CDS       T04345                                 

Gene name
LOC109787299
Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00620  Pyruvate metabolism
ats00710  Carbon fixation in photosynthetic organisms
ats01100  Metabolic pathways
ats01200  Carbon metabolism
Module
ats_M00168  CAM (Crassulacean acid metabolism), dark
ats_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ats_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ats_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109787299 (LOC109787299)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109787299 (LOC109787299)
Enzymes [BR:ats01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109787299 (LOC109787299)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: XP_020201445
LinkDB All DBs
Position
Unknown
AA seq 972 aa AA seqDB search
MASSAPGGGSGKIERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDL
REMVQECYEVAAEYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQI
AYRRRVKLKKGDFADENSAITESDIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHP
TQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQ
DEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPR
VTPEVTRDVCLLARMMAANLYCAQIEDLMFELSMWRCSDELRSRADELHRSSKKDAKHYI
EFWKKVPPNEPYRVILGDVRDNLYNTRERSRELLSSGHSDIPEEATLTNLEQLLEPLELC
YRSLCACGDRVIADGTLLDFLRQVSTFGLSLVKLDIRQESDRHTDALDAITSYLGIGSYR
EWSEERRQEWLLSELNGKRPLFGADLPMTEEVADVMGAFQVIAELPGDNFGAYVISMATS
PSDVLAVELLQRECHIKTPLRVVPLFEKLADLEAAPAALARLFSIDWYRERINGKQEVMI
GYSDSGKDAGRLSAAWQMYKAQEDLVKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQ
PPDTINGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALLDE
MAVVATEEYRSIVFQEPRFVEYFRLATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIF
AWTQTRFHLPVWLGFGGAFKHILKKDIRNFHMLQEMYNEWPFFRVTIDLVEMVFAKGNPG
IAALYDRLLVSEGLQPLGEKLRANYEETQKLLLQVAGHKDLLEGDPYLKQRLRLRDAYIT
TMNVCQAYTLKRIRDPDYHVALRPHLSKEVMDTSKPAAELVTLNPASEYAPGLEDTLILT
MKGIAAGLQNTG
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcggcgccgggcggcggcagcgggaagatcgagcggctgtcgtcgatcgac
gcgcagctgcgcctgctcgtcccggccaaggtgtccgaggacgacaagctcattgagtac
gacgcgctcctcctcgaccgcttcctcgacgtcctgcagggcctccacggcgacgatctc
agggagatggttcaagaatgctatgaggtggctgctgaatatgaaacaaagcatgacctg
gaaaagcttgatgaactcggagagatgataacaagtttggatcctggcgattctattgtg
atcgccaaagctttttcacacatgcttaacttggccaacttggctgaggaagtgcagatc
gcatacaggaggagggtcaagctcaagaagggagactttgctgatgaaaattcagcaatc
acagaatctgacatcgaggaaactcttaagaggcttgtttttgacatgaagaagtcccct
gctgaggtctttgatgccctcaagaatcagactgttgatctggttttgactgcacatcca
acacaatctgtaaggaggtcactgcttcagaagcattcgaggatccggaactgtttggtt
cagttatactcaaaggatatcactccagatgacaagcaggagcttgatgaggctctccag
agagagatccaagctgcctttagaactgatgagatccgaaggactcagcccactccccaa
gatgagatgcgtgctggtatgagctacttccatgagacaatatggaagggtgttccaaag
tttttgcgccgtgttgatacggcattgaagaacattgggatcaatgagcgtgttccttat
aatgctcctcttatccagttctcttcttggatgggtggagatcgtgatggaaatccaaga
gtgacaccagaggttacaagggacgtctgcttgcttgccagaatgatggcagctaatttg
tattgtgcacagattgaggatctcatgtttgagttgtctatgtggcgatgcagcgatgag
ctacgctcgcgagctgatgagctgcaccgctcttctaagaaggacgctaagcattacata
gagttctggaagaaggttcctccaaatgagccatatcgggtaatactgggtgatgttagg
gataatctttacaacacgcgtgagcgatcacgtgagttgttatccagtggacattccgac
atacctgaggaagctactctgacaaatcttgagcagctgttggagcccttggagctctgt
tacaggtcgctgtgtgcttgtggtgaccgtgttattgctgatggaacccttcttgatttc
ttgcgccaagtctctacctttggactttcccttgtgaagcttgacatcaggcaagagtct
gacaggcacactgatgctcttgatgctatcacctcatacctgggaataggatcttatcgt
gagtggtctgaggaacgccgtcaagaatggctgttgtctgaactcaatgggaagcgccca
ttatttggtgcagaccttcccatgacagaggaagttgctgatgttatgggcgcgttccag
gttattgctgagctgcctggtgacaattttggagcatatgtcatatcaatggcaacatct
ccttcagatgttcttgctgtggagctcctccaacgtgagtgccatatcaagacaccactt
agagttgtccccctgtttgagaagttggctgatcttgaggctgccccagcagcactggcc
agactcttctcaatagattggtacagagagaggatcaatggcaagcaggaggtcatgatt
gggtattcagactcaggcaaggacgcaggccgtctctcagcagcttggcagatgtacaag
gctcaggaggacctcgtcaaggtcgctaagcaatttggagtgaaattgacgatgttccat
ggacgaggtgggactgttggaaggggtggtggccccactcatcttgccatcttgtctcag
ccaccggacacgatcaatggatcactccgggtcactgttcagggtgaagttatcgagcag
agctttggggaggaacacttgtgcttcaggacgctccagcgtttcacagctgctactctt
gagcatgggatgcgtccacccatttcaccaaagccagagtggcgagctcttctcgatgag
atggctgtggtggcaactgaagaatatcggtcaattgtcttccaagaaccacgcttcgtc
gagtatttccgccttgcaacaccggagacagagtatggcaggatgaacataggaagcagg
ccatccaagagaaagccaagtggtggcattgaatcactccgtgcaatcccatggatcttt
gcatggacgcagacacggttccacctcccggtctggctgggctttggtggcgccttcaag
catatcctcaagaaggacatcaggaacttccacatgctccaggagatgtacaacgagtgg
ccattcttcagggtcaccatcgatcttgttgagatggtgttcgccaagggtaatcctggc
attgctgccctgtatgacaggctcctagtttcagaggggctgcagccactgggtgagaag
ctgagggccaactatgaggagacccagaagctgcttcttcaggttgctggacacaaggat
cttcttgaaggtgatccctacctgaagcagcggctccgcctccgtgacgcgtacatcacc
accatgaatgtctgccaagcatacacattgaagaggatccgtgacccagactaccatgtt
gcgctgcgcccccatctgtccaaggaggtgatggacacgagcaagccggctgctgagctc
gtgacgctgaatccggcgagtgagtacgcgccggggctggaggataccctcatcttgacc
atgaagggcattgctgccggtctgcagaacaccggttag

DBGET integrated database retrieval system