KEGG   Acinetobacter sp. TTH0-4: AMQ28_02025Help
Entry
AMQ28_02025       CDS       T04075                                 

Definition
(GenBank) oxidoreductase
Organism
att  Acinetobacter sp. TTH0-4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 NAD_binding_6 FAD_binding_6 Fer2 Rep_1B
Motif
Other DBs
NCBI-ProteinID: ALD01240
UniProt: A0A0M5JJ22
LinkDB All DBs
Position
complement(411427..412494)
Genome map
AA seq 355 aa AA seqDB search
MHVLEKIKSPLGSLAESVIDQHAANFWLQKFNPLWSFSEALGKIVKKETPAQHMVSLTIQ
FNRHFDVGQAGQHHPLFINVKGIRYERSYSLTQIDAQHVLLTVKKVDQGKVSSWLVEQSQ
VGDVLEFGQPYGDMLLPEYAQPMILLAAGSGITPMLSLLKALSKTQRITQAPIHLMYWVS
KYHDFAFKARFEALAAQYPNFSFQVFYTQESDAGDRLSQQHVALVSDIESSVVYACGPSG
FVTQAEQLFTHAHSFKSEAFSMTPVENSELGFVNITLLKSKKILTIPKGQSILTSLEQQN
IKPTHGCRMGICNKCVCSKAEGSTKNLVNGSRNSEPGNMLKICVNSAQSDLVIDL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttttagaaaaaattaaatctcccctaggttcattagctgaaagtgttattgat
cagcatgcagctaatttttggttgcagaaatttaatccgctttggtcatttagcgaagca
ctgggtaaaattgttaaaaaagaaacacccgctcagcatatggtgagtttaactattcag
ttcaatcgtcattttgatgtcggccaagcaggtcagcatcatcctttatttatcaatgtg
aaaggtattcgatatgagcgcagctatagtctgacgcaaattgatgcacagcatgtctta
ttgactgtgaaaaaagttgatcagggtaaagtcagttcttggctggtagaacagtctcaa
gtcggtgatgtacttgagtttggacaaccttatggtgatatgttgttaccagaatatgct
caacctatgattttgctggctgcggggagtggaattactcctatgctgagtttgttgaaa
gctttatcgaaaacgcagcgaatcactcaagcaccgattcatttgatgtattgggtcagc
aagtatcatgattttgctttcaaagcgcgctttgaagctctagcagcacagtatcctaat
ttttcatttcaggtgttttatacccaagagagtgatgcaggcgatcgtcttagtcagcaa
catgtagctttagtatctgatattgaaagtagtgtggtgtatgcgtgtgggccatcggga
tttgtaactcaggccgagcaattatttactcatgcacacagctttaaaagtgaagctttt
agcatgactccagttgaaaattctgagcttggttttgtcaatatcaccttattgaaatcc
aaaaaaatactgaccattccaaaaggtcaatctattttaaccagtcttgaacagcaaaat
attaaaccgacccatggttgtcgaatgggaatttgtaataaatgtgtttgttctaaagct
gaaggatcgaccaaaaacttggtcaacggtagccgaaactcagaacccggcaatatgctg
aaaatctgcgtgaattctgcacaatctgatcttgttattgatttataa

DBGET integrated database retrieval system