KEGG   Acinetobacter sp. TTH0-4: AMQ28_02585Help
Entry
AMQ28_02585       CDS       T04075                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
att  Acinetobacter sp. TTH0-4
Brite
KEGG Orthology (KO) [BR:att00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMQ28_02585
Enzymes [BR:att01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AMQ28_02585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C DAO Thi4 FAD_binding_3 K_oxygenase NAD_binding_8 Glutaredoxin FMO-like Spermine_synth Methyltransf_34
Motif
Other DBs
NCBI-ProteinID: ALD01338
UniProt: A0A0M4GG22
LinkDB All DBs
Position
complement(526324..527889)
Genome map
AA seq 521 aa AA seqDB search
MLDQNTSAQLKTLLERLESPIELVVSLNDSDKSEKIKELVTEVAALSDQVSVRFDGTNSR
RPSFGIAKVGEQARVNFAGLPMGHEFTSLILALLQVSGYAPKVSDDVLAQIKGLNLSSDF
EVFVSLSCHNCPDVVQALNLIAIHNPGTTATMVDGAFFQDEVEQRKIMAVPMLFQNGEHI
GQGRMTLEEIVAKLDSSSSSKDLEKLNAKEVFDVLVIGGGPAGNTAAIYAARKGIHTGIV
AERFGGQVMDTMDIENYTSVQKTQGPKFAAEMEAHVRAYDVDIMNLQKVSSIKGADETAH
GRVEVTLENGAILESKTIILSTGARWREMNVPGEQEYKTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTQLRADQVLQNKLHSLPNTTVILNALSTEVIGD
GSQVTALKYQDRATNTEHTVELAGIFVQIGLLPNTDFLQASNVELSKRGEIVINDRNETN
VQGVFAAGDCTTVPYKQIIISTGEGAKAALSAFDYLIRAEG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatacctcagcacaattaaaaacactccttgaacgtttagaaagtcca
attgaattggttgtctccttaaatgattcagacaaatctgaaaaaatcaaagaactggtc
accgaagtggctgcattgtctgatcaagtcagcgtacgttttgatggaactaatagccgt
cgtccaagttttggtattgccaaagtcggagaacaagctcgggtgaactttgcaggttta
ccgatgggacatgagttcacttctttgattttggctttgttacaagtctcaggttatgca
cccaaagtctctgatgacgttttggcacaaatcaaaggcttaaacttaagctctgacttt
gaagtatttgtgtctttaagctgtcataactgtccagatgtggtgcaagccttaaaccta
attgcgattcacaatccaggtacgacagcaaccatggttgatggtgcattctttcaagat
gaagtagaacagcgcaaaatcatggccgtcccgatgctgttccaaaatggtgaacatatc
ggtcaaggtcgtatgactttagaagaaattgtggccaagcttgattcaagctcatctagt
aaagatctagaaaaactcaatgccaaagaggtctttgatgtactggtgattggaggtggt
cctgccggcaatactgctgccatttatgctgcacgaaaagggattcacaccggtattgtg
gcagaacgcttcggtggacaagtcatggataccatggacattgaaaactacacctcggtg
caaaaaacccaagggccaaagtttgccgctgaaatggaggcccatgtacgtgcttatgat
gtagacatcatgaacctacaaaaagtgtcgagcatcaaaggtgcagatgaaacagcgcat
ggacgggttgaagtgactttagaaaatggtgccattctggaatctaaaaccattattttg
tcgactggtgcacgttggagagagatgaatgtaccgggtgagcaagaatacaaaactcgt
ggtgtggcttactgtccacactgtgacggccctttgtttaaaggcaaacgtgtggccgtg
attggtggtggtaattcaggggttgaagcggcgattgatttggcgggtattgttgaacat
gtgactttggttgaatttgatacccaactgcgtgccgaccaagtgttacagaacaaactg
catagtttgcctaacaccacggtgattttgaatgctttatccactgaagtgattggtgat
ggttcacaagtaacggcactgaaatatcaagatcgtgccacgaatacggaacatacagtt
gaactggctggaatctttgttcaaattggtttattaccgaatacagactttttgcaagca
tccaacgttgagctgtctaagcgaggtgaaattgtgattaatgatcgcaatgaaaccaat
gttcaaggggtatttgcagcgggtgattgtacgactgtaccgtataagcagattattatt
tcgacaggtgaaggtgcgaaggctgcattatctgcctttgattatttgatccgcgctgag
gggtaa

DBGET integrated database retrieval system