KEGG   Acinetobacter sp. TTH0-4: AMQ28_05245Help
Entry
AMQ28_05245       CDS       T04075                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att00330  Arginine and proline metabolism
att01100  Metabolic pathways
att01110  Biosynthesis of secondary metabolites
att01130  Biosynthesis of antibiotics
att01230  Biosynthesis of amino acids
Module
att_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:att00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AMQ28_05245
Enzymes [BR:att01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     AMQ28_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N PDH NAD_binding_2 DUF4624
Motif
Other DBs
NCBI-ProteinID: ALD01817
UniProt: A0A0M3RL12
LinkDB All DBs
Position
complement(1104473..1105303)
Genome map
AA seq 276 aa AA seqDB search
MSAALNCNICFIGGGNMAQALIGGLISRGLPATRITVSDPVENVRVFLSEKDVHVTDDNV
AAIRDADIVVFAVKPQVLTNVLKPLKGLFTDKLVMSIVAGAEIATIAQLLDTDQVVRVMP
NTPALVQTGAHGLYATAAVDTQSRELASQVLAATGLTIWVNSEAQIDAVTAVSGSGPAYF
FYMMESMIRAGKNLGLDEKVATALTLQTALGAAQMAITSANTPAELRKNVTSPNGTTQAA
LEVFDRAQISQNIQAALAAAQKRSQELAQELSESSK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagcattaaattgtaatatttgttttattggcggtggtaatatggcccaagcc
ttaattggtgggctaatttcacgtggattgcctgcaacacgtattacagtttccgatcct
gtcgaaaatgtacgcgtttttctctcagaaaaagatgtgcatgtgaccgatgataatgtt
gctgccattcgtgatgcggatatcgttgtttttgcggtgaaaccacaagtgctgactaat
gtactcaaaccgcttaaaggtctgtttactgacaaattagtgatgtcgattgtggctggt
gctgaaatagccaccattgctcaactcttggatacagaccaagttgttcgcgtgatgcca
aatactccagctttggtacagactggagcacatggtttgtatgcgactgctgcggtagat
acacaaagtcgtgaacttgctagtcaagttttagctgcaactggactgacaatttgggta
aattcagaagctcaaattgatgcagtcacagcagtttctggttctggtccagcatatttt
ttctatatgatggaaagcatgattcgtgcaggaaaaaacttaggtttagatgaaaaagtg
gccactgcattaaccttgcaaaccgctttgggcgctgcacaaatggcgattaccagtgca
aatacacctgctgaattacgtaaaaatgtgacttcgccaaatgggacgacccaagctgca
cttgaagtatttgatcgtgcgcaaatctctcaaaatattcaggctgctttggctgctgcg
caaaagcgtagccaagaacttgctcaagagttaagtgaaagtagtaaataa

DBGET integrated database retrieval system