KEGG   Acinetobacter sp. TTH0-4: AMQ28_09745Help
Entry
AMQ28_09745       CDS       T04075                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att00400  Phenylalanine, tyrosine and tryptophan biosynthesis
att01100  Metabolic pathways
att01110  Biosynthesis of secondary metabolites
att01130  Biosynthesis of antibiotics
att01230  Biosynthesis of amino acids
Module
att_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:att00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMQ28_09745 (aroK)
Enzymes [BR:att01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AMQ28_09745 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_22 Cytidylate_kin AAA_5 TsaE AAA AAA_16 Cytidylate_kin2 AAA_28 CHDNT dNK AAA_23 Mg_chelatase RNA_helicase GhoS ABC_tran Ploopntkinase3 CoaE
Motif
Other DBs
NCBI-ProteinID: ALD02607
UniProt: A0A0M3RLH0
LinkDB All DBs
Position
2054541..2055089
Genome map
AA seq 182 aa AA seqDB search
MPSNEFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEG
EKGFRHRETMVINELTARTELVLATGGGAVTQSPNREFLKQRGIVVYLYTPVEIQLQRTY
RDKNRPLLQVENPEQKLRDLLTLRDPLYREVAHYIIETNQGAARDLAQKILHLIMAQEAD
LI
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgccaagcaatgagtttgaaaccctaccaaatatttatttggtagggccaatgggggct
gggaaaacaacggttggtcgacatttagcggaactattaggacgtgagtttcttgatagt
gatcatgaaattgagcgtaaaacaggagcgactataccttggatttttgaaaaagaaggt
gaaaaaggatttcgtcatcgtgagaccatggtgattaatgagcttacagcacgcacagaa
ttggttctcgctacaggaggtggggcagtcactcaatctcctaatcgtgaatttttaaaa
caacgtggcattgttgtttatctttatactcctgtcgaaattcaattacagcgtacttat
cgggataagaaccgtcctttattgcaagttgaaaatcctgaacaaaagttacgtgattta
ttgacacttcgtgatccattatatcgagaagttgcacattatattattgaaaccaatcag
ggtgctgcgcgtgatttggcgcaaaaaattcttcatttaattatggctcaagaagcagat
ttaatttaa

DBGET integrated database retrieval system