KEGG   Acinetobacter sp. TTH0-4: AMQ28_12980Help
Entry
AMQ28_12980       CDS       T04075                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att00020  Citrate cycle (TCA cycle)
att00480  Glutathione metabolism
att01100  Metabolic pathways
att01110  Biosynthesis of secondary metabolites
att01120  Microbial metabolism in diverse environments
att01130  Biosynthesis of antibiotics
att01200  Carbon metabolism
att01210  2-Oxocarboxylic acid metabolism
att01230  Biosynthesis of amino acids
Module
att_M00009  Citrate cycle (TCA cycle, Krebs cycle)
att_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:att00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMQ28_12980
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMQ28_12980
Enzymes [BR:att01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AMQ28_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH UBM
Motif
Other DBs
NCBI-ProteinID: ALD03169
UniProt: A0A0M4GYF3
LinkDB All DBs
Position
2716896..2719133
Genome map
AA seq 745 aa AA seqDB search
MAGGKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGVEIVKSDISVAVRVLAEFADYLSD
EQKVPDTLAELGRLTQDPDTNIIKLPNISASVGQLTACIKELQSKGYAIPDYPENPTTDE
EKAIKARYSKCLGSAVNPVLREGNSDRRAPAAVKNYVKKHPHSMSGWKQWSQTHVSHMEE
GDFYHGEKSMTLDRARNVKMELITQSGETVILKPKVALKDGEIIDSMFMSKKALCDFYEK
QLEDCREAGILFSLHVKATMMKVSHPIVFGHCVRIYYKEAFEKHGKLFDELGINVNNGMS
GLYEKIQTLPTSLREEIIEDLHACQEHRPALAMVDSAKGITNFHSPNDVIVDASMPAMIR
GGGKMWGADGKQYDCKAVMPESTFARIYQEMINFCKWNGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEAGIANITDLDTGEVLMTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVEEYLKEHDTEGLDIQIMSQVRAMRYTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFMALAVSLEEMGIKENNAGAKLLAKTLDQATGKLLDNDKSPSRRTGELDNR
GSHFYLAKYWAQELAAQDENAELKAKFAPLAKTLAENEDKIVAELASVQGKSVDIGGYYA
VDQEKVDAIMRPSATLNAALEAAQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtggaaagtcaacaattatttacacactgaccgatgaggcgccactactagcg
acctattcgttactgccgatcattgagacctttactaagccagctggcgtcgagatcgtc
aaaagtgacatttctgtagccgtacgtgtgcttgcagaattcgcagattacctcagtgat
gaacagaaggtccctgacacgctcgcagagctaggtcgtcttactcaagatccagatact
aatattattaagctcccaaatatcagtgcatctgttggtcaattaacagcatgtattaaa
gagcttcagtctaaaggatatgcaattcctgattatcctgaaaatccaaccactgatgaa
gaaaaagccattaaggcgcgttatagcaagtgcttgggttctgctgtaaacccagtattg
cgtgaaggtaactctgaccgtcgtgcacctgctgctgtaaaaaactatgtgaaaaagcat
cctcactctatgagcggatggaagcaatggtcacaaacacatgtttcacacatggaagaa
ggcgacttctaccacggtgaaaaatcaatgacgcttgaccgcgcacgcaacgtaaaaatg
gaattgatcactcaatcgggcgaaaccgttattcttaagccaaaagttgcgcttaaagat
ggcgaaatcatcgactctatgttcatgagcaaaaaagcactgtgtgatttctacgagaaa
caactcgaagattgtcgtgaagcaggtattttgttctcattacacgtcaaagcgaccatg
atgaaagtttctcatccgatcgtatttggtcactgtgtgagaatttattataaagaagcg
ttcgagaagcacggtaaattattcgatgagcttggcattaacgtgaataacggtatgtcg
ggtctttacgaaaaaatccaaactttaccgacttcattacgcgaagaaatcattgaagat
ttacacgcttgtcaggaacaccgtcctgcgttagctatggtcgattcagctaaaggcatt
accaacttccattcaccgaacgacgtgattgtagatgcatctatgcctgcaatgatccgt
ggtggcggtaaaatgtggggtgctgacggcaagcaatacgactgtaaagctgtgatgcct
gaatcaactttcgcacgtatttatcaagaaatgattaatttctgtaaatggaatggcaat
ttcgatccgaaaacgatgggtactgtgcctaacgttggtttgatggcgcagaaagcagaa
gaatacggttctcacgataaaactttcgaaatcgctgaagcgggtattgcgaacatcact
gatctagatactggtgaagtgttgatgactcaaaacgttgaggaaggcgacatttggcgt
atgtgtcaggtgaaagatgcaccgatacgtgattgggtaaaacttgcagtaacacgtgca
cgtaattcaggcatgcctgcaattttctggcttgacccgtaccgtccacatgaaaatgag
ttgatcaagaaagtcgaagaatacttgaaagagcatgacactgaaggtttagatatccaa
atcatgtcacaagttcgtgcgatgcgttatacacttgaacgtgtggcccgtggtcttgat
acaatttcagtgacaggtaatattttacgtgattacttgactgacttgttcccaatcatg
gaattgggtacatctgcgaaaatgttatcgattgtaccattgatggctggcggtggtatg
tacgagactggtgcaggtggttcggctccgaaacacgttcaacagttagttgaagaaaac
catttgcgttgggattcactgggtgaattcatggctttggctgtttcgctagaagaaatg
ggcattaaagaaaacaatgctggtgcaaaattgcttgcgaaaacacttgaccaagccaca
ggtaagttacttgataatgacaagtcaccatcacgccgtactggtgagcttgataaccgt
ggtagtcacttctacttagcgaaatattgggctcaagaacttgctgcgcaggatgaaaat
gctgagctgaaagcgaagtttgctccgcttgcgaaaacattggctgagaacgaagataaa
attgttgctgaacttgcttccgttcaaggtaagtcggttgatatcggtggttactacgct
gtagatcaagagaaagtagatgcgatcatgcgtccaagtgctacgcttaatgcagcgctt
gaagctgctcaagcttaa

DBGET integrated database retrieval system