KEGG   Acinetobacter sp. TTH0-4: AMQ28_12980Help
Entry
AMQ28_12980       CDS       T04075                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att01100  Metabolic pathways
att01110  Biosynthesis of secondary metabolites
att01120  Microbial metabolism in diverse environments
att01130  Biosynthesis of antibiotics
att01200  Carbon metabolism
att01210  2-Oxocarboxylic acid metabolism
att01230  Biosynthesis of amino acids
Module
att_M00009  Citrate cycle (TCA cycle, Krebs cycle)
att_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:att00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMQ28_12980
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMQ28_12980
Enzymes [BR:att01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AMQ28_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALD03169
UniProt: A0A0M4GYF3
LinkDB All DBs
Position
2716896..2719133
Genome map
AA seq 745 aa AA seqDB search
MAGGKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGVEIVKSDISVAVRVLAEFADYLSD
EQKVPDTLAELGRLTQDPDTNIIKLPNISASVGQLTACIKELQSKGYAIPDYPENPTTDE
EKAIKARYSKCLGSAVNPVLREGNSDRRAPAAVKNYVKKHPHSMSGWKQWSQTHVSHMEE
GDFYHGEKSMTLDRARNVKMELITQSGETVILKPKVALKDGEIIDSMFMSKKALCDFYEK
QLEDCREAGILFSLHVKATMMKVSHPIVFGHCVRIYYKEAFEKHGKLFDELGINVNNGMS
GLYEKIQTLPTSLREEIIEDLHACQEHRPALAMVDSAKGITNFHSPNDVIVDASMPAMIR
GGGKMWGADGKQYDCKAVMPESTFARIYQEMINFCKWNGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEAGIANITDLDTGEVLMTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVEEYLKEHDTEGLDIQIMSQVRAMRYTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFMALAVSLEEMGIKENNAGAKLLAKTLDQATGKLLDNDKSPSRRTGELDNR
GSHFYLAKYWAQELAAQDENAELKAKFAPLAKTLAENEDKIVAELASVQGKSVDIGGYYA
VDQEKVDAIMRPSATLNAALEAAQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtggaaagtcaacaattatttacacactgaccgatgaggcgccactactagcg
acctattcgttactgccgatcattgagacctttactaagccagctggcgtcgagatcgtc
aaaagtgacatttctgtagccgtacgtgtgcttgcagaattcgcagattacctcagtgat
gaacagaaggtccctgacacgctcgcagagctaggtcgtcttactcaagatccagatact
aatattattaagctcccaaatatcagtgcatctgttggtcaattaacagcatgtattaaa
gagcttcagtctaaaggatatgcaattcctgattatcctgaaaatccaaccactgatgaa
gaaaaagccattaaggcgcgttatagcaagtgcttgggttctgctgtaaacccagtattg
cgtgaaggtaactctgaccgtcgtgcacctgctgctgtaaaaaactatgtgaaaaagcat
cctcactctatgagcggatggaagcaatggtcacaaacacatgtttcacacatggaagaa
ggcgacttctaccacggtgaaaaatcaatgacgcttgaccgcgcacgcaacgtaaaaatg
gaattgatcactcaatcgggcgaaaccgttattcttaagccaaaagttgcgcttaaagat
ggcgaaatcatcgactctatgttcatgagcaaaaaagcactgtgtgatttctacgagaaa
caactcgaagattgtcgtgaagcaggtattttgttctcattacacgtcaaagcgaccatg
atgaaagtttctcatccgatcgtatttggtcactgtgtgagaatttattataaagaagcg
ttcgagaagcacggtaaattattcgatgagcttggcattaacgtgaataacggtatgtcg
ggtctttacgaaaaaatccaaactttaccgacttcattacgcgaagaaatcattgaagat
ttacacgcttgtcaggaacaccgtcctgcgttagctatggtcgattcagctaaaggcatt
accaacttccattcaccgaacgacgtgattgtagatgcatctatgcctgcaatgatccgt
ggtggcggtaaaatgtggggtgctgacggcaagcaatacgactgtaaagctgtgatgcct
gaatcaactttcgcacgtatttatcaagaaatgattaatttctgtaaatggaatggcaat
ttcgatccgaaaacgatgggtactgtgcctaacgttggtttgatggcgcagaaagcagaa
gaatacggttctcacgataaaactttcgaaatcgctgaagcgggtattgcgaacatcact
gatctagatactggtgaagtgttgatgactcaaaacgttgaggaaggcgacatttggcgt
atgtgtcaggtgaaagatgcaccgatacgtgattgggtaaaacttgcagtaacacgtgca
cgtaattcaggcatgcctgcaattttctggcttgacccgtaccgtccacatgaaaatgag
ttgatcaagaaagtcgaagaatacttgaaagagcatgacactgaaggtttagatatccaa
atcatgtcacaagttcgtgcgatgcgttatacacttgaacgtgtggcccgtggtcttgat
acaatttcagtgacaggtaatattttacgtgattacttgactgacttgttcccaatcatg
gaattgggtacatctgcgaaaatgttatcgattgtaccattgatggctggcggtggtatg
tacgagactggtgcaggtggttcggctccgaaacacgttcaacagttagttgaagaaaac
catttgcgttgggattcactgggtgaattcatggctttggctgtttcgctagaagaaatg
ggcattaaagaaaacaatgctggtgcaaaattgcttgcgaaaacacttgaccaagccaca
ggtaagttacttgataatgacaagtcaccatcacgccgtactggtgagcttgataaccgt
ggtagtcacttctacttagcgaaatattgggctcaagaacttgctgcgcaggatgaaaat
gctgagctgaaagcgaagtttgctccgcttgcgaaaacattggctgagaacgaagataaa
attgttgctgaacttgcttccgttcaaggtaagtcggttgatatcggtggttactacgct
gtagatcaagagaaagtagatgcgatcatgcgtccaagtgctacgcttaatgcagcgctt
gaagctgctcaagcttaa

DBGET integrated database retrieval system