KEGG   Agrobacterium fabrum: Atu0112
Entry
Atu0112           CDS       T00070                                 

Gene name
rpmF
Definition
(RefSeq) 50S ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
atu  Agrobacterium fabrum
Pathway
atu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:atu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Atu0112 (rpmF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:atu03011]
    Atu0112 (rpmF)
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu0112 (rpmF)
Ribosome [BR:atu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Atu0112 (rpmF)
  Bacteria
    Atu0112 (rpmF)
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu0112 (rpmF)
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-GeneID: 1132150
NCBI-ProteinID: NP_353148
UniProt: Q8UJ26
LinkDB
Position
circular:117212..117397
AA seq 61 aa
MAVPKRKTSPSKRGMRRSADGLKSATYVEDKNSGELRRPHHIDLKTGMYRGRQVLTPKES
A
NT seq 186 nt   +upstreamnt  +downstreamnt
atggctgtaccaaaaagaaaaacaagcccgtccaagcgtggcatgcgccgctcggctgac
ggtctcaagtctgcaacctatgttgaagacaagaactccggcgaactgcgccgtccgcac
catatcgatctgaagaccggtatgtatcgcggccgtcaggttctgacgccgaaggaaagc
gcataa

DBGET integrated database retrieval system