KEGG   Agrobacterium fabrum: Atu0876Help
Entry
Atu0876           CDS       T00070                                 

Gene name
sodBI
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
atu  Agrobacterium fabrum
Brite
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Atu0876 (sodBI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 1132914
NCBI-ProteinID: NP_353898
UniProt: A9CJS9
LinkDB All DBs
Position
circular:872849..873451
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS
FGTNAGLFNNAAQHYNHVHFWKWMKKDGGGNKLPGKLEQAFASDLGGYDKFKADFIAAGT
TQFGSGWAWLSVKNGKLEISKTPNGENPLVHGADPILGVDVWEHSYYIDYRNLRPKYLEA
FVDNLINWDYVLERYEAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgaacttcctgaactcccctacgactatgacgcgcttgcaccttacatgtcg
cgcgagacgctcgagttccatcacgacaagcaccacaaggcttatgtcgacaacggcaac
aagctggctgcagaagccggtctttccgacctgtcgctcgaagaagtcgtgaagaagtcg
tttggcaccaatgccggcctcttcaacaatgctgcccagcactacaaccacgtccatttc
tggaagtggatgaagaaggacggcggcggcaacaagctgccgggcaagctggaacaggca
ttcgcttccgatctcggcggctacgacaagttcaaggcagatttcatcgctgccggcacc
acgcagttcggctccggctgggcatggctctccgtcaagaacggcaagcttgaaatctcc
aagaccccgaacggtgaaaacccgctggttcacggcgcagatccgatcctcggcgtcgac
gtatgggaacactcctattacatcgactaccgcaacctgcgtccgaagtacctcgaagcc
ttcgttgataacctcatcaactgggactacgtcctggagcgttacgaagccgctgccaag
taa

DBGET integrated database retrieval system