KEGG   Agrobacterium fabrum: Atu1036
Entry
Atu1036           CDS       T00070                                 

Definition
(RefSeq) GTP-binding protein, Era family
  KO
K03595  GTPase
Organism
atu  Agrobacterium fabrum
Brite
KEGG Orthology (KO) [BR:atu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:atu03009]
    Atu1036
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu1036
Ribosome biogenesis [BR:atu03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Atu1036
 Prokaryotic type
  GTPases
   Atu1036
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu1036
SSDB
Motif
Pfam: MMR_HSR1 KH_2 GTP_EFTU FeoB_N Dynamin_N RsgA_GTPase PduV-EutP AIG1 MMR_HSR1_Xtn cobW SRPRB AAA_22 ABC_tran AAA_29 Roc RHD3 Arf Ras
Other DBs
NCBI-GeneID: 1133074
NCBI-ProteinID: NP_354059
LinkDB
Position
circular:1028238..1029179
AA seq 313 aa
MTDHENPAVTGEDNALPTRSGFVALIGPTNAGKSTLVNRLVGAKVSIVSHKVQTTRAVMR
GIAIHKNAQIVFMDTPGIFKPRRRLDRAMVTSAWGGAKDADLILLLIDSERGLKGDAEAI
LEGLKDVPQKKILCLNKIDQVKREDLLKLAAAANEKVAFDRTFMISATNGSGCEDLMDYL
VETLPEGPWYYPEDQISDLPMRQLAAEITREKLFLRLHQELPYASHVETEKWEERKDGSV
RIEQVIYVERDSQKKIALGKNGDAIKAISTASRKELSEILEQPVHLFLFVKVRENWGDDP
ERFREMGLEFPRG
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaccgatcacgaaaatcccgccgtaacgggcgaagacaatgcccttccgacccgttcc
ggtttcgtcgccctcatcggcccgaccaatgctggaaaatcgacgctggtgaaccggctg
gtgggcgccaaagtctcgatcgtcagccacaaggtgcagacgacgcgcgcggtcatgcgc
ggcatcgccattcacaagaatgcgcagatcgttttcatggacacgcccggcatcttcaag
ccgcgccgcaggctcgaccgcgccatggtcacttcggcttggggtggtgcgaaggatgcg
gatctcattctgctgctgatcgacagcgagcgcggcctgaagggtgatgccgaggccatt
ctcgaagggctgaaggatgttccgcagaagaaaatcctgtgcctcaacaagatcgaccag
gtgaagcgcgaagaccttctgaagctcgccgccgccgccaacgaaaaggtcgcgtttgat
cgcaccttcatgatttccgccaccaacggttcgggctgcgaagacctgatggattatctg
gtggagaccctgccggaaggcccgtggtattatccggaagaccagatttccgatctgccg
atgcgccagctcgccgccgaaatcacccgcgaaaaactcttcctgcgcctgcatcaggaa
cttccctatgcctcgcatgtcgagacggaaaagtgggaagagcgcaaggatggctccgtg
cgcatcgagcaggtgatctatgtcgagcgcgacagccagaagaagatcgcgctcggcaag
aacggcgatgcgatcaaggcgatctccaccgcctcgcgcaaggagctgtcagaaatcctc
gagcagccggtgcatctcttcctgttcgtgaaggtccgcgagaactggggcgacgacccc
gagcgcttccgtgaaatgggtctggaattcccgcggggttaa

DBGET integrated database retrieval system