KEGG   Agrobacterium fabrum: Atu1091
Entry
Atu1091           CDS       T00070                                 

Gene name
rpsF
Definition
(RefSeq) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
atu  Agrobacterium fabrum
Pathway
atu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:atu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Atu1091 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:atu03011]
    Atu1091 (rpsF)
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu1091 (rpsF)
Ribosome [BR:atu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Atu1091 (rpsF)
  Bacteria
    Atu1091 (rpsF)
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu1091 (rpsF)
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
NCBI-GeneID: 1133129
NCBI-ProteinID: NP_529003
UniProt: Q8UGE7
LinkDB
Position
circular:complement(1082017..1082478)
AA seq 153 aa
MALYEHIFLARQDISAQQVDALVEQYKGVIESFGGKVGRVENWGLKSLTYRIKKNRKAHY
ALMDIDAPAAAVHEVERQMRINEDVLRYMTIAVEAHEEGPSAMMQKRDRDDRPRRDGDRP
DRGPREDRGPRPPREGGFGDREDRPRRPREDRA
NT seq 462 nt   +upstreamnt  +downstreamnt
atggctctttacgaacacatcttccttgcccggcaggatatttctgcccagcaggtcgac
gcacttgtcgagcagtacaagggcgttatcgaatcgttcggcggtaaagtcggacgcgtc
gagaactggggtctgaagtccctcacctaccgcatcaaaaagaaccgcaaggctcactac
gctctcatggacatcgacgctccggcggctgcagttcatgaagtcgagcgccagatgcgc
atcaacgaagacgttcttcgctacatgactatcgccgtcgaagcccacgaagaaggcccg
tccgcgatgatgcagaagcgcgaccgtgacgaccgtccgcgccgtgacggcgaccgtccg
gaccgtggcccgcgtgaagatcgtggtccgcgtccgccgcgcgaaggtggcttcggcgac
cgcgaagaccgtccgcgccgtccgcgcgaagaccgtgcataa

DBGET integrated database retrieval system