KEGG   Agrobacterium fabrum: Atu1153
Entry
Atu1153           CDS       T00070                                 

Definition
(RefSeq) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
atu  Agrobacterium fabrum
Pathway
atu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:atu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Atu1153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:atu01007]
    Atu1153
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:atu03016]
    Atu1153
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu1153
Enzymes [BR:atu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Atu1153
Amino acid related enzymes [BR:atu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Atu1153
Transfer RNA biogenesis [BR:atu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Atu1153
 Prokaryotic type
   Other AARSs
    Atu1153
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu1153
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Other DBs
NCBI-GeneID: 1133191
NCBI-ProteinID: NP_354172
UniProt: Q8UG87
LinkDB
Position
circular:1144725..1146512
AA seq 595 aa
MHRYRSHTCAALRKSDVGETVRLSGWVHRVRDHGGVLFIDLRDHYGITQVVADPDSPAFK
VAETVRGEWVIRIDGLVKARSEDTINKGMATGEIELYAQEIEVLGVAKELPLPVFGEPEY
PEDVRLKYRFLDLRRETLHRNIVKRTQIISSMRKGMGDLGFAEYTTPILTASSPEGARDF
LVPSRIHEGQFFALPQAPQQYKQLLMVAGFDRYFQIAPCFRDEDPRADRLPGEFYQLDVE
MSFVTQEDVWTTMEPMMTAVFEQFAEGKPVTKQWPRIPYDESIRKYGSDKPDLRNPIVME
AVTEHFDGSGFKVFANMIASNPKVQVWAIPAKTGGSRAFCDRMNAWAQSQGQPGLGYIFW
KEEEGKVAGSGPLAKNIGEERTEALRQQLGLEAGDACFFVAGDPAKFYKFAGEARTRAAD
ELNLIDRDRFEMCWIVDFPFFEYNEEEKKIDFAHNPFSMPQGGMEALEGQDPLSIKAFQY
DAVCNGFEIASGSIRNQSPELMVKAFEKVGLSQSDVEERFGGLYRAFQYGAPPHGGCAFG
IDRVVMLLVGAKNLREITLFPMNQQAQDLLMNAPSPATPTQLRELALRVVPSKKD
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcatcgttatcgcagccacacctgtgccgctctccgcaagtccgacgtcggcgaaacc
gttcgcctttccggttgggttcatcgcgtgcgagatcatggcggcgttctcttcatcgac
cttcgcgaccattacggcatcacccaggtggtggccgatcctgatagcccggccttcaag
gttgcagaaaccgtgcgcggcgaatgggtcatccgcatcgacggtctagtcaaggcgcgt
tcggaagacaccatcaacaaaggcatggcgaccggcgagatcgagctttacgcgcaggag
atcgaagttcttggtgttgccaaggaactgccactgccggtgttcggcgagcctgaatat
cccgaagacgtccgcctgaagtatcgcttcctcgaccttcgccgcgaaaccctgcacagg
aacatcgtcaagcgcacgcagatcatctcctccatgcgcaagggcatgggcgatctgggc
tttgccgaatatacgacgccgatcctcactgcatcctcgccggaaggcgcgcgcgacttc
ctcgtgccctcgcgcatccacgaaggtcagttcttcgcgctgccgcaggcgccgcagcag
tacaagcagcttctgatggttgccggtttcgaccgctacttccagatcgccccctgcttc
cgcgatgaagacccgcgtgccgaccgtctgccgggcgaattctaccagctcgacgtcgaa
atgagcttcgtgacccaggaagatgtctggaccacgatggagccgatgatgacggccgtg
ttcgaacagtttgccgaaggcaagccggtgacgaaacagtggccgcgcatcccctatgac
gaatcgatccgtaaatacggttccgacaagccggacctgcgtaacccgatcgtcatggaa
gccgtgactgagcatttcgacggttcgggcttcaaggtcttcgccaacatgatcgcttcc
aaccccaaggttcaggtctgggcgatccccgccaagaccggcggttcgcgcgctttctgc
gaccgcatgaacgcctgggcgcagtctcagggccaacccggcctcggctacatcttctgg
aaggaagaagaaggcaaggttgccggttcgggtccgcttgccaagaacatcggcgaagaa
cgcaccgaggcgctgcgccagcagctcggtctcgaggcgggcgatgcctgcttcttcgtt
gctggtgatcccgccaagttctacaagttcgccggcgaggcgcgcacccgcgctgccgac
gagttgaacctgatcgaccgcgaccgcttcgaaatgtgctggatcgtcgatttcccgttc
ttcgaatacaacgaagaagaaaagaagatcgatttcgcccacaaccccttctccatgccg
cagggtggaatggaagcgctggaagggcaggacccgctctccatcaaggcgttccagtat
gacgcggtctgcaacggttttgaaatcgcttccggctcgatccgtaaccagtcgcccgag
ctgatggtcaaggctttcgaaaaggttggcctctcgcagagcgatgtggaagagcgcttc
ggcggtctctatcgtgccttccagtatggcgcgcctccgcatggcggttgcgccttcggt
atcgaccgtgtcgtcatgctgctggtcggtgcgaagaacctgcgcgaaatcacgctgttc
ccgatgaaccagcaggcgcaggaccttctgatgaatgcgccgtcgccggcaacgccaaca
cagcttcgcgaactggcgctgcgcgtcgttccgtccaagaaggactga

DBGET integrated database retrieval system