KEGG   Agrobacterium fabrum: Atu1176
Entry
Atu1176           CDS       T00070                                 

Definition
(RefSeq) hypothetical protein
  KO
K17662  cytochrome b pre-mRNA-processing protein 3
Organism
atu  Agrobacterium fabrum
Brite
KEGG Orthology (KO) [BR:atu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu1176
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu1176
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-III assembly factors
    Atu1176
SSDB
Motif
Pfam: Ubiq_cyt_C_chap
Other DBs
NCBI-GeneID: 1133214
NCBI-ProteinID: NP_354195
UniProt: Q7CZT6
LinkDB
Position
circular:1170283..1170819
AA seq 178 aa
MIFGLFKKKNNNRAIVDRQYATLTAAARTPAFYLDLGVPDTVMGRFEMLSVIMILYFRRT
KSSGVSGQEIAQEIVDAFFQDIDHSIRELGIGDQGVPKRMKKFAGMFYGRLESYAAALDA
SDCAALAAALRRNIYPQVDDEAPEMEGLAGWMMETSDALAAQSEETIATGSLTLPLPI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgatattcgggctgttcaagaagaaaaacaacaaccgcgccatagtcgaccggcaatat
gcgaccttgacggcggctgcgcgcacgcccgccttttatctcgatctaggtgttcccgat
accgtcatgggccgtttcgagatgctctcggtcatcatgattctctatttccgccgcacc
aaatcatcaggtgtcagcgggcaggagatcgcccaggagatcgtcgatgcctttttccag
gatatcgatcactccatccgtgaattggggataggtgatcagggcgtgccgaaacgcatg
aagaaattcgccggcatgttctatgggcggctcgaatcctatgcggcggcactggatgca
tccgactgcgccgctcttgccgcagcgctccggcgcaatatatatccgcaggtagacgac
gaggctcccgagatggaggggctggcgggctggatgatggaaacatccgatgcccttgcc
gcccagtccgaagagacgatagcaaccggaagcctgacgctgcccctgcctatatga

DBGET integrated database retrieval system