KEGG   Agrobacterium fabrum: Atu1383Help
Entry
Atu1383           CDS       T00070                                 

Gene name
fabZ
Definition
(RefSeq) (3R)-Hydroxymyristoyl-(acyl carrier protein)-Dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
atu  Agrobacterium fabrum
Pathway
atu00061  Fatty acid biosynthesis
atu00780  Biotin metabolism
atu01100  Metabolic pathways
atu01212  Fatty acid metabolism
Module
atu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Atu1383 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Atu1383 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:atu01004]
    Atu1383 (fabZ)
Enzymes [BR:atu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Atu1383 (fabZ)
Lipid biosynthesis proteins [BR:atu01004]
 Fatty acid synthase
  Component type
   Atu1383 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-GeneID: 1133421
NCBI-ProteinID: NP_354390
UniProt: Q8UFL4
LinkDB All DBs
Position
circular:1377948..1378412
Genome map
AA seq 154 aa AA seqDB search
MADETKATLGTADILEVMKLLPHRYPFLLIDKIIEIDGDSSAIGIKNVTVNEPHFTGHFP
DRPIMPGVLIVEAMAQTAGAICARNQGEGGHLVYFMTIDNARFRRPVVPGDRLEIHVVKQ
RQRGNVFKFHCEAKVEGALVAEADVGAMMIPEGQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaaacgaaggcgacgcttggcacggccgacatcttggaagtcatgaaactt
ctgccgcatcgttacccgtttttgctcatcgacaagatcatcgagatcgatggcgacagt
tcggcgatcggcatcaagaacgtgacggtcaacgaaccgcatttcaccggccatttccct
gatcggccgatcatgccgggcgttctgatcgtcgaggcgatggcccagacggccggcgcc
atctgcgcccgtaaccagggcgagggcggtcatctcgtttatttcatgaccatcgacaac
gcgcgtttccgcagaccagtggttccgggcgatcgcctcgaaatccatgtggtcaagcag
cgccagcgcggcaatgtgtttaagttccattgcgaagcgaaggtcgaaggcgcgctcgtg
gcggaagccgatgtcggcgcgatgatgatccccgagggccagtaa

DBGET integrated database retrieval system