KEGG   Agrobacterium fabrum: Atu1871Help
Entry
Atu1871           CDS       T00070                                 

Gene name
gst
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
atu  Agrobacterium fabrum
Pathway
atu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Atu1871 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atu02000]
    Atu1871 (gst)
Enzymes [BR:atu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Atu1871 (gst)
Transporters [BR:atu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Atu1871 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 1133909
NCBI-ProteinID: NP_354852
UniProt: A9CII7
LinkDB All DBs
Position
circular:1849834..1850460
Genome map
AA seq 208 aa AA seqDB search
MSELIFYTNPMSRGRIARWMLEEVGIPYKTEILGFETSMKSPAYRLINPMAKVPAIKHGD
TIVTEAAAICAYLADAFPGANLAPTPKARGLYYRWMFFAAGPLEMAASMKAMGFEVPKEK
LRMAGCGSYADVMNTLERAVSENRFIAGDLFTAADVYVGAHVGWGLHFGTIEKRPAFTDY
MAHLTDRPAFKRAAQLDEEAAKELQAAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattgatcttttataccaatcccatgtcgcgcgggcgcatcgcgcgatggatg
ctcgaggaagtgggcattccctataaaacggaaatactgggtttcgaaacctcgatgaaa
tcgccagcctaccggctgattaacccgatggcgaaggtgccggcaatcaagcacggcgac
accatcgtcaccgaggcggcagcgatctgcgcctatctggccgatgcttttcccggcgca
aatcttgcgcccacaccgaaggcgcgcgggctttattatcgctggatgtttttcgcagca
ggccccctggaaatggcggcaagcatgaaggcgatgggttttgaagtgcccaaggagaaa
ctgcgcatggccggttgcggcagctatgccgatgtgatgaacacgctggagcgcgccgtc
agcgaaaaccgctttatcgccggtgatctctttaccgccgcggatgtctatgtcggcgcc
catgtcggctgggggctacacttcggcaccatcgaaaagaggccggcctttaccgattat
atggcgcatctgaccgaccggccggccttcaaacgggccgcccagctcgatgaagaggcg
gccaaggagttgcaggcggctggataa

DBGET integrated database retrieval system