KEGG   Agrobacterium fabrum: Atu1948Help
Entry
Atu1948           CDS       T00070                                 

Gene name
tuf
Definition
(RefSeq) elongation factor TU
  KO
K02358  elongation factor Tu
Organism
atu  Agrobacterium fabrum
Brite
KEGG Orthology (KO) [BR:atu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:atu03012]
    Atu1948 (tuf)
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu1948 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:atu04147]
    Atu1948 (tuf)
Translation factors [BR:atu03012]
 Eukaryotic Type
  Elongation factors
   Atu1948 (tuf)
 Prokaryotic Type
   Atu1948 (tuf)
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Atu1948 (tuf)
Exosome [BR:atu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Atu1948 (tuf)
  Exosomal proteins of breast cancer cells
   Atu1948 (tuf)
  Exosomal proteins of colorectal cancer cells
   Atu1948 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 1133986
NCBI-ProteinID: NP_354924
UniProt: Q8UE16
LinkDB All DBs
Position
circular:complement(1916029..1917204)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVTRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPEGTEMVMPGDNVTVEVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgagcgcaataagccgcacgtcaacattggcacgatcggtcac
gtcgaccacggcaagacgtcgttgactgctgcgatcacgaagtatttcggcgagttcaag
gcgtatgaccaaatcgacgccgctcctgaggaaaaggcccgtggtatcacgatttcgacg
gcgcacgttgagtatgagacgcctgcgcgtcactacgcccacgttgactgccccggccac
gccgactatgtgaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtt
tgctcggctgccgacggcccgatgccacagacccgcgagcacatcctgcttgcccgtcag
gttggcgttccggccatcgtcgtgttcctcaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagcttgaagttcgcgaacttctgtcgtcctacgacttcccgggc
gacgatatcccgatcatcaagggttcggcacttgctgctcttgaagattctgacaagaag
atcggtgaagacgcgatccgcgagctgatggctgctgtcgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggt
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgtcaaggttggtgaagaagtc
gaaatcgtcggcatccgtccgacctcgaagacgactgttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggtgcactcgttcgcggcgttacc
cgtgacggcgtcgagcgtggtcagatcctgtgcaagccgggttcggtcaagccgcacaag
aagttcatggcagaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcacgaactaccgtccgcagttctacttccgtacgactgacgttaccggtatcgtttcg
cttcctgaaggcacggaaatggttatgcctggcgacaacgtcactgttgaagtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgtacc
gtcggcgccggcatcgttgcttcgatcgtcgagtaa

DBGET integrated database retrieval system