KEGG   Agrobacterium fabrum: Atu2089Help
Entry
Atu2089           CDS       T00070                                 

Gene name
ddlB
Definition
(RefSeq) D-alanylalanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
atu  Agrobacterium fabrum
Pathway
atu00473  D-Alanine metabolism
atu00550  Peptidoglycan biosynthesis
atu01100  Metabolic pathways
atu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Atu2089 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Atu2089 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Atu2089 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:atu01011]
    Atu2089 (ddlB)
Enzymes [BR:atu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Atu2089 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:atu01011]
 Precursor biosynthesis
  Amino acid ligase
   Atu2089 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 1134127
NCBI-ProteinID: NP_355054
UniProt: Q8UDN3
LinkDB All DBs
Position
circular:complement(2051211..2052137)
Genome map
AA seq 308 aa AA seqDB search
MGGKHVAVLLGGFSSERPVSLSSGNACALALEGEGYKVTRVDVGRDVAAVLDELRPDVAF
NALHGPFGEDGTIQGILEYLAIPYTHSGVLASALAMDKAQAKKVAAAAGIPVAGERVMNR
FDFTSEHPLQPPYVVKPVREGSSFGVVIVKEDQSHPPQILTSSEWPFGNQVMVERYIHGR
ELTCGVLDGEALGVTEVVPLGHNFYDYDAKYAAGGSKHVIPAGISPKIYQKIQTLAVMAH
QAIGCRGVSRSDFRYDDRFSEDGEVIWLEVNTQPGMTPTSLVPEMAAHAGRSFGDLVSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagcacgtagctgttcttttgggtggattttcgtcggagcggccggtcagt
ctctcgtcgggcaacgcctgcgcgcttgcgctcgaaggcgaaggctacaaggtcacccgt
gttgatgtggggcgcgatgtcgccgccgtactcgatgagctgcgcccggatgtcgccttc
aacgccctgcatggccccttcggcgaggacggcaccattcagggtatcctcgaatatctg
gccattccctatacacattccggcgtgctggcgtccgcccttgccatggataaggcgcag
gccaagaaggttgccgccgccgctggcatcccggttgctggcgagcgcgtcatgaaccgc
ttcgatttcaccagcgaacatccgctgcagccgccctatgtggtgaagccggtgcgcgaa
ggttcgagcttcggggtcgtcatcgtcaaggaagaccagtcgcatccgccgcagattctc
acctcgtcggaatggcctttcggcaaccaggtgatggtcgagcgctacattcatgggcgc
gaactgacctgtggcgtgctcgacggcgaggcgctgggcgtcaccgaagtggtgccgctg
ggtcacaatttctatgattatgatgcgaaatacgctgctggtggctcgaaacatgtcatt
cccgcaggaatttcaccgaaaatttaccaaaagattcaaacattggcggttatggcgcat
caggcgatcgggtgccgtggcgtaagccgttcagactttcgttacgacgaccgcttctca
gaagatggcgaagttatctggcttgaagtgaatacgcagccgggcatgacgccgacctcc
ctggtgccggaaatggcggcccatgctggccgctcctttggtgaccttgtcagctggatg
gtggaggacgcttcgtgtttgcggtga

DBGET integrated database retrieval system