KEGG   Agrobacterium fabrum: Atu2642Help
Entry
Atu2642           CDS       T00070                                 

Gene name
sdhB
Definition
(RefSeq) succinate dehydrogenase iron-sulfur
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
atu  Agrobacterium fabrum
Pathway
atu00020  Citrate cycle (TCA cycle)
atu00190  Oxidative phosphorylation
atu00650  Butanoate metabolism
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
Module
atu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
atu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
atu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Atu2642 (sdhB)
   00650 Butanoate metabolism
    Atu2642 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Atu2642 (sdhB)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Atu2642 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Atu2642 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 1134680
NCBI-ProteinID: NP_355579
UniProt: A9CHJ9
LinkDB All DBs
Position
circular:complement(2627940..2628719)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSQISEGKVWPKPDGAKNVREYRIYRWNPDDGQNPRIDTYYIDVDDCGPMVL
DALLYIKNNIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMEEIKGTVKVYPLPHMP
VVKDLVPDLSNFYAQHRSIEPWLKTVSPTPAKEWKQSHEDRLKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEATGERLDNLEDPFRLYRCHTIMNCAQACPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgctctccccaagaattcccagatcagcgaaggcaaggtctggccgaag
cctgacggtgccaagaatgtgcgcgaataccgcatctatcgctggaacccggatgacggt
cagaacccgcgcatcgatacctattacatcgatgtcgatgattgcgggccgatggttctc
gatgcactgctttacatcaagaataatatcgacccgacgctgacgctgcgtcgctcctgc
cgcgaaggcatttgtggttcctgtgcgatgaacatcgacggcaccaatacgcttgcctgc
accaagggtatggaagagatcaagggtacggtaaaggtttatccgctgccgcatatgcct
gtcgtgaaggacctcgttcccgatctgtcgaacttctacgcccagcaccgctccatcgag
ccctggctgaagacggtgtctccgacgcccgccaaggaatggaagcagagccatgaggat
cgtctgaagctggatggtctttacgagtgcatcctgtgcgcctgctgctccacctcctgt
cccagctactggtggaatggcgaccgttatctcggccccgccgttctgctgcaggcctat
cgctggctgatcgacagccgcgatgaggcaaccggtgagcgtctcgacaatctcgaggac
ccgttccgcctttatcgttgccacaccatcatgaactgcgcacaggcttgcccgaagggc
ttgaacccggccaaggcgatcgcggaaatcaagaagatgatggtcgagcgtcgcgtctaa

DBGET integrated database retrieval system