KEGG   Agrobacterium fabrum: Atu2643Help
Entry
Atu2643           CDS       T00070                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
atu  Agrobacterium fabrum
Pathway
atu00020  Citrate cycle (TCA cycle)
atu00190  Oxidative phosphorylation
atu00650  Butanoate metabolism
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
Module
atu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
atu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
atu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Atu2643 (sdhA)
   00650 Butanoate metabolism
    Atu2643 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Atu2643 (sdhA)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Atu2643 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Atu2643 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 DAO Thi4 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 1134681
NCBI-ProteinID: NP_355580
UniProt: A9CHJ8
LinkDB All DBs
Position
circular:complement(2628735..2630576)
Genome map
AA seq 613 aa AA seqDB search
MASISSPSQNGKAYTYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTV
AAQGGIAASLTNMTPDCWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYGVPFS
RNAEGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFIEYFA
LDLIMAPDGRCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMI
ARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASR
DVVSRCMTMEIREGRGVGKNKDHIFLHLDHLDPAILHERLPGISESAKIFAGVDVTREPI
PVLPTVHYNMGGIPTNYWGEVLNADANNPERIAPGLMAVGEAGCASVHGANRLGSNSLID
LVVFGRAAAIRAAQVIDRDAPVPALDIAACDKIMERFDSLRYANGSTPTAVLRDKMQRAM
QDDAAVFRTQESLESGCQRLSAIWKELPDVKVTDRSMVWNSDLVETLELHNLMANAITTV
YGAEARKESRGSHAREDFVDGPFGGRDDVNWRKHTLAWVSPEGDVKLDYRPVHTDLIADG
IDPKKIEPKARVY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgatcagttcaccttcccagaatggcaaggcctacacctatgtcgatcactcc
tatgacgtgatcgtggtgggcgccggtggcgccggtctacgcgcaacgctcggcatggcg
gaacagggtttccgcacggcctgcatcaccaaggttttcccgacccgctcccacacggtc
gcggcgcagggcggcattgccgcatcgcttaccaacatgacgcccgactgttggcagtgg
cacctttacgacaccgtaaagggctccgactggctgggcgacgtcgatgcgatgcaatat
ctcgccatggaagcgccgaaggcggtctatgagctggaacattacggcgtgcccttctcg
cgcaatgccgagggcaagatttaccagcgcccgttcggcggtcacatgcagaattacggc
gaaggcccaccggtacagcgcacctgtgctgccgccgaccgtaccggccacgccattctg
cacacgctctatggccagtcgctgcgcaacaatgcggaattcttcatcgaatatttcgcg
ctcgacctcatcatggcgccagatggtcgttgcacgggcgtcgttgcctggaacctcgat
gacggcacgatccatcgattctccgccaagatggtggtgctggcgaccggcggttacggc
cgcgcctatttctcggcgacctctgctcacacctgcaccggcgacggcggcggcatgatt
gcccgtgccggcctgccgcttcaggacatggaattcgtacagttccatccaaccggcatt
tatggcgcaggctgcctcatcaccgaaggcgcgcgtggcgaaggcggttacctcgtcaac
tcagaaggcgaacgcttcatggagcgttatgcgccatcggcgaaggaccttgcctcccgt
gacgttgtctcccgctgcatgacgatggaaatccgtgaaggccgcggcgtcggcaagaac
aaggatcacatcttcctgcatctggatcacctcgatcctgcgatcctgcatgagcggctt
ccgggcatttccgaaagcgccaagatttttgccggcgtggacgtgacgcgcgagcccatc
ccggttctgccgacggttcactataatatgggcggtattccgaccaactattggggtgaa
gtgctgaatgccgatgccaataacccggaacgtatcgcgcccggtctgatggccgtcggc
gaagccggttgcgcctcggttcacggtgccaaccgcctcggctccaactcgctgatcgac
ctcgtggtcttcggccgcgccgccgctattcgtgcagcacaggtcatcgaccgcgatgcg
cccgttcctgcgctcgacattgcggcctgcgacaagatcatggagcgcttcgacagcctg
cgttacgccaatggctcgacgccgacggcggtgctgcgcgacaagatgcagcgcgccatg
caggacgatgcggccgttttccgcacgcaggaatcgctggagagcggttgccagcgtctt
tccgccatctggaaggagctgccggacgtcaaggtcaccgaccgttcgatggtctggaac
tccgatctggtcgagacgctcgagctacacaatctgatggccaacgcgatcaccacggtc
tatggcgctgaagcgcgcaaggaaagccgcggttcacacgcccgtgaggatttcgtcgat
ggtcctttcggcggtcgcgacgacgtgaactggcgcaagcacacgctcgcctgggtcagc
cccgaaggggacgtcaaactcgattatcgcccggttcacaccgacctgatcgccgacggc
atcgatcccaaaaagatcgagccgaaggcgcgcgtctactga

DBGET integrated database retrieval system