KEGG   Agrobacterium fabrum: Atu2699
Entry
Atu2699           CDS       T00070                                 

Gene name
rpsP
Definition
(RefSeq) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
atu  Agrobacterium fabrum
Pathway
atu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:atu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Atu2699 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:atu03011]
    Atu2699 (rpsP)
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu2699 (rpsP)
Ribosome [BR:atu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Atu2699 (rpsP)
  Bacteria
    Atu2699 (rpsP)
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu2699 (rpsP)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-GeneID: 1134737
NCBI-ProteinID: NP_355634
UniProt: Q8UBZ9
LinkDB
Position
circular:2683966..2684346
AA seq 126 aa
MALKIRLARGGSKKRPYYQIVVADARSPRDGRFLEKVGSWNPMLAKDNPLRVELKADLIK
EWIAKGAQPTDRVLRFLAEAGLAERAARSNPEKALPGKRALERVAEKKQKAEDAAAAAAA
EASAAE
NT seq 381 nt   +upstreamnt  +downstreamnt
atggcactgaaaattcgtctcgcacgcggtggttccaagaagcgcccgtattaccagatc
gtcgttgctgacgcccgttcgccccgcgacggccgtttcctcgagaaggtcggttcctgg
aacccgatgcttgccaaggacaacccgctgcgcgttgagctgaaggctgacctcatcaag
gaatggatcgccaagggcgcacagccgaccgaccgcgttctgcgcttcctcgcagaggca
ggccttgccgagcgcgccgctcgcagcaacccggaaaaggcactgccgggcaagcgcgct
ctggaacgcgttgctgaaaagaagcagaaggctgaagatgcagccgctgctgctgctgcg
gaagcctctgctgcagaataa

DBGET integrated database retrieval system