KEGG   Agrobacterium fabrum: Atu2748
Entry
Atu2748           CDS       T00070                                 

Gene name
leuS
Definition
(RefSeq) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
atu  Agrobacterium fabrum
Pathway
atu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:atu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Atu2748 (leuS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:atu01007]
    Atu2748 (leuS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:atu03016]
    Atu2748 (leuS)
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu2748 (leuS)
Enzymes [BR:atu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     Atu2748 (leuS)
Amino acid related enzymes [BR:atu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Atu2748 (leuS)
Transfer RNA biogenesis [BR:atu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Atu2748 (leuS)
 Prokaryotic type
    Atu2748 (leuS)
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu2748 (leuS)
SSDB
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1f tRNA-synt_1e zf-ribbon_3
Other DBs
NCBI-GeneID: 1134786
NCBI-ProteinID: NP_355678
UniProt: Q8UBV2
LinkDB
Position
circular:2746106..2748736
AA seq 876 aa
MAIERYNPRDAEPRWQQKWNEDKVFVTDNSDPREKYYVLEMFPYPSGRIHMGHVRNYAMG
DVVARYKRARGFNVLHPMGWDAFGMPAENAAMQNKVHPKDWTYQNIATMRGQLKSMGLSL
DWTREFATCDVEYYHRQQALFVDFMEKGLVYRKQSKVNWDPVDHTVLANEQVIDGRGWRS
GALVEQRELTQWFFRITDFSQDLLDELDELDQWPEKVRLMQKNWIGRSEGLSLRWQTVAD
TAPQGFSDITVYTTRPDTLFGASFLAIAADHPLAKELSATNPAIAEFCDECRRHGTSLAA
LETAEKKGIDTGVKVVHPLDPSWELPVYVANFVLMDYGTGAIFGCPSGDQRDLDFARKYG
LPVVAVVAPEGPDAASFTVEDTAFTDDGVMINSSFLNGMKTTDAFEAVVQKLSAQSLGNA
PQAERKVNFRLRDWGISRQRYWGCPIPVIHCEVCGVVPVPKKDLPVKLPDDVTFDVPGNP
LDRHSTWRHVSCPQCGHDARRETDTMDTFVDSSWYYTRFTAPWEDEPTDPQVANHWLPVD
QYIGGIEHAILHLLYSRFFTRAMRETGHVGVKEPFKGLFTQGMVVHETYSRGEGLTREWV
PPAELRIEENDGTRRAFLLSSGEEVKIGSIEKMSKSKKNVVDPDDIIASYGADTARFFVL
SDSPPDRDVIWSEAGVEGANRFVQRVWRIIGEAAEQLKGVKPKPATEGEGLAASKAAHKT
LKAVQEDLDKLAFNKAIARIYELVNALAGPLADVAAGGKPDNVKAAARDAVEILIRIIAP
MTPHLAEECWSALGNEGLVAETPWPTFVASLVEENDVVMPVQVNGKKRGELTIARDADQD
AVRTAALELDAVKSILAGGEPKKVIVVPQRIVNIVV
NT seq 2631 nt   +upstreamnt  +downstreamnt
atggccatcgaacgttacaatcctcgcgacgccgagccgcgctggcagcagaaatggaac
gaagacaaggttttcgtcaccgataacagcgatccgcgcgagaaatattacgttctagag
atgtttccctatccctcgggacgcatccatatgggccatgtccgcaactacgccatgggt
gacgtcgtcgcccgttacaaacgcgcccgtggtttcaacgtcctgcacccgatgggctgg
gacgcctttggcatgcccgctgaaaatgcggctatgcagaacaaggtccatcccaaggac
tggacctaccagaacatcgccaccatgcgcggccagctgaaatccatgggcctgtcgctg
gactggacccgcgaattcgccacctgcgatgtggaatattaccatcgtcagcaggcgctg
ttcgtcgacttcatggaaaagggtctggtttaccgcaagcagtccaaggtcaactgggac
ccggtcgaccacacggttctggccaatgagcaggtgatcgacggccgcggctggcgctcc
ggcgcactggtcgaacagcgcgaactgacgcaatggttcttccgcatcaccgattttagc
caggacctgctggacgaactggacgaactggatcagtggcctgaaaaagtgcgcctgatg
cagaagaactggatcggccgttccgaaggcctgtcgctgcgctggcagaccgtcgctgac
acggcgccgcaaggtttctccgacattaccgtctatacaacgcgtcccgacacgctgttc
ggtgcgtccttcctggcaatcgccgccgaccatccgcttgcaaaggaactgtcggcgacc
aaccctgccattgccgaattctgcgacgaatgccgccgccatggcacctcattggcagcg
ctggaaaccgccgaaaagaagggcatcgataccggcgtcaaggtcgtgcacccgctggat
cccagctgggaactgcccgtctatgtcgccaatttcgtattgatggattacggcaccggc
gcaatcttcggctgcccttcgggtgaccagcgtgatctggacttcgcccgcaaatacggc
ctgccggtcgtcgccgtcgtcgcacccgaaggtcccgacgcagcaagcttcaccgttgaa
gacaccgccttcaccgatgatggcgtgatgatcaattccagcttcctgaacggcatgaag
acgacggacgccttcgaagccgtcgtgcagaagctgtcggcgcagtctctcggcaatgca
ccgcaggccgagcgcaaggtcaatttccgcctgcgcgactggggcatttcccgccagcgt
tactggggttgcccgatcccggtcattcattgcgaagtctgcggcgtggtgccggttccg
aaaaaggacctgcccgtcaagctgcccgacgacgtgactttcgatgtgcccggcaacccg
ctggatcgccattctacctggcgtcatgtttcctgcccgcaatgcggccatgacgcgcgt
cgcgaaacagacacgatggacaccttcgtcgattccagctggtattacacccgcttcaca
gcgccgtgggaagacgagccgactgacccgcaagttgccaatcactggctgccggttgac
cagtatatcggcggcatcgagcatgccatcctgcacctgctctattcgcgtttcttcacc
cgcgcgatgcgcgagacaggtcatgtcggcgtcaaggaacccttcaagggcctgtttacc
cagggcatggtggtccacgagacctatagccgcggtgaaggcctgacgcgcgaatgggtg
ccgcctgcggaactgaggatcgaggaaaacgacggcacgcgccgggcgttcctgctctct
tctggcgaagaggttaagatcggctccatcgaaaaaatgtcgaagtcgaagaagaacgtg
gtcgaccctgacgatatcatcgcatcctatggcgccgataccgcacgcttcttcgtcctc
tcggattctccacccgatcgcgacgtcatctggtccgaagccggcgtggaaggtgcaaac
cgattcgtccagcgcgtctggcgcatcatcggtgaagccgccgaacagttgaagggtgtg
aaaccgaagccggcgaccgaaggcgaagggctggcggcctccaaggcagcccacaagacg
ctgaaggctgttcaggaagatctggacaagctcgccttcaacaaggccatcgcccgcatc
tatgaactggtcaatgccctcgccggtccgcttgcggatgtcgctgccggcggcaaacct
gataacgtcaaggcggccgcgcgtgacgccgtcgaaatcctgatccgcatcatcgcgccc
atgacgccgcatctcgcggaagaatgctggtccgcgctgggcaatgaaggcttggtggct
gagacgccatggccgaccttcgtggcttcgctggtcgaggaaaacgacgtggtcatgccc
gtgcaggtcaatggcaagaagcgcggtgaattgacaatcgcgcgcgatgcggatcaagat
gcggtccgcacggccgcccttgagctggacgccgtcaaatcgattcttgccggtggcgag
cccaagaaagtcatcgtggttccgcagaggattgtgaacattgttgtctga

DBGET integrated database retrieval system