KEGG   Agrobacterium fabrum: Atu2753
Entry
Atu2753           CDS       T00070                                 

Gene name
mgpS
Definition
(RefSeq) ATP-dependent helicase
  KO
K17675  ATP-dependent RNA helicase SUPV3L1/SUV3 [EC:3.6.4.13]
Organism
atu  Agrobacterium fabrum
Brite
KEGG Orthology (KO) [BR:atu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu2753 (mgpS)
Enzymes [BR:atu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Atu2753 (mgpS)
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu2753 (mgpS)
SSDB
Motif
Pfam: Helicase_C
Other DBs
NCBI-GeneID: 1140164
NCBI-ProteinID: NP_355683
UniProt: A9CHE4
LinkDB
Position
circular:complement(2751305..2754403)
AA seq 1032 aa
MILSGRGVTAVLGPTNTGKTHYAIERMVAHGNGVIGLPLRLLAREVYTRLVEKVGAPNVA
LITGEEKISPPKAKYSVCTVEAMPRETTAAFVAIDEVQLAGDLERGHIFTDRVLHLRGRE
ETLLLGAGTMRPILEKLLPGITVVERPRLSQLFYAGQKKITRLPQRTAIVAFSAEEVYAI
AELVRRQRGGAAVVMGALSPRTRNAQVGLYQSGDVEYLVATDAIGMGLNLDVDHVAFAQD
RKFDGYQFRNLNPGEIGQIAGRAGRHLRDGTFGVTGRVDPFDDELVERIETHQFDAVKVL
QWRTKNFDFSSIANLRLSLDAAPTIQGLSRALPAIDQQALEYLSRYPEIIDVTTTDARVE
KLWEACALPDYRRIAPAQHADLISTLYFDLVKRGTVNEDFMAEQVRRADRTDGEIDTLSA
RIAQIRTWTYVSNRPGWLADPTHWQEKTREIEDRLSDALHERLTKRFVDRRTSVLMRRLR
ENAMLEAEISVNGDVFVEGHHVGQLAGFRFTPVSGMEGPDQKAVQAASQKALALEYEARA
ARLHASGNGDLALSSDGLVRWLGEPVARLAAGDNIMKPRVILLADEQLSGNARDHALARV
ERFVNHQIATVLKPLDDISRAEDLQGLAKGLAFQLVENLGVLFRRDVTEDVKSLDQDARA
SMRRYGVRFGAYHVFLPALLKPAPAELVTLLWALKNDGLGKPGYGDLIPVLAAGRTSVVT
DASFERMFYKLAGFRFLGKRAVRIDILERLADLIRPLLQWKPGQQPRPEGAYDGRRFTTT
TAMLSILGATLDDMEEILKGLGYRADQVTAEEAQAFLASQAGAAAPVAAEAVTGEEENAE
TEQDEPASEQQETETAVVAEGDASEAPVAEAVGEEVAAGEAASAEGAELSEPKPVLLWRP
GGRNENQRGENRRPGHRGQARDGAREQGERRGEGRRDNRDGANRDNNRDGANREAANRGS
DGERKRDGGRPDRGNNRNNDRGERKDRPERNDRGGKTQGQQRFEAKPPRKEKPMDPDSPF
AKLAALKEQLKK
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgatcctgagcggccgcggtgtcacggccgttctcggccccaccaataccggcaagacc
cattacgcgatcgagcgaatggtggcgcatggcaacggtgtcatcggcctcccactgcgc
cttctggcgcgggaggtctatacccgtctggttgaaaaggtgggggcgccgaatgtggcg
ctgataaccggcgaagaaaaaatctcaccgcccaaagccaaatattccgtctgcaccgtg
gaagccatgccgcgcgagacgaccgccgccttcgtcgcgatcgacgaggtgcagctggcc
ggcgatcttgagcgtggccatatcttcaccgaccgggtgctgcatctgcgcgggcgggag
gaaacgctgcttctgggtgccggcacgatgcgcccgatcctcgaaaagctgctgccggga
ataaccgtggtcgagcggccgcgcctgtcgcagcttttttatgcgggccagaagaagata
acccgcctgccacaacgtacggcgatcgtcgccttttcggcggaagaggtctatgccatt
gccgagttggtgcggcgccagcgcggtggcgccgccgttgtaatgggtgcgctttcgccg
cgcacgcgcaatgcgcaggtggggctctaccagtcgggcgatgtggaatatcttgtcgcg
acggatgccatcggcatgggtctcaacctcgatgtcgatcacgtcgccttcgcgcaggac
cgcaaattcgacggttaccagttccgcaacctcaatccgggtgaaatcggccagattgcc
ggccgcgccggccgtcatcttcgcgatggcacattcggtgtgacggggcgtgtcgatccg
ttcgatgacgaattggtcgagcggatcgaaacccatcagtttgatgcggtgaaggtgctg
cagtggcggacgaaaaacttcgatttttcctccattgccaatctgcgcctgagccttgat
gccgcgccgacgatccaggggctttcgcgcgccctgccggcgatcgaccagcaggcgctg
gaatatctgtcgcgttatcctgagatcatcgacgtaacgacaacggatgcgcgggtggaa
aaactctgggaggcctgcgcgctgcccgattatcgccgcatcgcccccgcacagcatgcc
gatctgatctccacgctctatttcgatctggtcaaacgcgggaccgtgaacgaagatttc
atggccgaacaggtgcgccgtgctgaccgaacagatggagagatcgataccttgtctgca
aggattgcgcagatcagaacatggacttatgtatcgaaccgcccaggatggcttgccgat
ccgacacactggcaagaaaagacgcgggaaatcgaggatcgattgtccgatgcgctacat
gaaaggttgacgaaacgctttgttgatcgcaggacatctgtgctcatgaggcgcctgaga
gagaatgcgatgcttgaagctgaaatcagtgtaaatggtgatgtcttcgtagaaggacat
cacgtcggccaattggccggattccggttcacgccggtatcgggaatggaagggccggat
cagaaggccgtgcaggctgcgtcgcagaaggcgctggcgctcgagtatgaggcgcgcgct
gcgcgtctgcatgccagcggcaacggcgatctcgctttgagttccgatggtctggttcgc
tggcttggcgaaccggttgcccgcctcgcggcaggcgataacatcatgaagccgcgggta
atcctgctggccgacgagcagttgagcggcaatgcccgcgatcatgcgctggcgcgcgtc
gaacgtttcgtcaatcatcagattgcgaccgtgctgaagccgctcgacgatatttcgcgc
gccgaagaccttcagggtctcgcaaagggactggcgttccagctggtcgaaaatctgggc
gtgctgttccgccgcgacgtcaccgaagacgtgaagtcgctggatcaggatgcgcgcgcc
tccatgcgccgctacggcgtgcgttttggcgcttatcatgtcttcctgcccgcgcttctg
aagcccgctccggcggagctcgtgacgctgctctgggcgctgaagaacgatggtcttggc
aagccgggttacggcgatctcattccggtgctggccgccggccgcacctcggtcgtgacg
gatgcgagcttcgagcggatgttctacaagctcgccggtttccgtttcctcggaaagcgc
gccgtgcgtatcgacattctggagcgtctggccgatctgatccgtccactgctgcagtgg
aagcccggtcagcagccgcgcccggaaggcgcttatgatggccgccgtttcacgacgacg
accgccatgctttccatcctcggtgcaacgctcgacgacatggaagaaatcctcaagggc
ctcggttaccgagctgatcaggttacggcggaagaggcgcaggccttcctcgccagccag
gccggtgctgccgctcctgttgccgcagaagcggtgacgggcgaagaggaaaacgctgag
accgaacaggacgagccggcttccgaacaacaggaaaccgaaacggcggttgttgctgaa
ggcgacgcttccgaggcacctgtcgcggaagccgtcggtgaagaggttgccgcaggtgag
gccgcgtctgccgaaggcgctgagctttcggagccgaagcctgttcttctgtggcgtccg
ggtggtcgcaacgaaaatcagcgcggcgaaaaccgtcgtcccggccatcgcggtcaggct
cgtgacggcgcacgcgagcagggcgagcgtcgcggcgaaggccgtcgcgacaatcgtgac
ggtgcaaaccgcgacaataatcgcgacggtgcgaatcgcgaagcagccaatcgcggtagc
gatggcgagcgcaagcgtgacggcggtcgccccgatcgcggaaacaaccgcaacaatgat
cgcggggagcgcaaggaccggccggagcgcaacgaccgtggcggaaaaacgcagggtcag
cagcgcttcgaagccaagccaccgcgcaaggagaagccgatggatccggattcgcccttc
gcaaagctcgctgcgctcaaggagcagctgaagaagtaa

DBGET integrated database retrieval system