KEGG   Agrobacterium fabrum: Atu3292Help
Entry
Atu3292           CDS       T00070                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
atu  Agrobacterium fabrum
Pathway
atu00473  D-Alanine metabolism
atu01100  Metabolic pathways
atu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Atu3292 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Atu3292 (alr)
Enzymes [BR:atu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Atu3292 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:atu01011]
 Precursor biosynthesis
  Racemase
   Atu3292 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 1135166
NCBI-ProteinID: NP_357313
UniProt: P58737
LinkDB All DBs
Position
linear:317717..318883
Genome map
AA seq 388 aa AA seqDB search
MDMQISRQQAAGGASGHLTIDLGALRDNYLTLAGMAPASQTAAVVKADAYGLGADVVSQT
LFEAGCRNFFVAHIDEALALRLRLSAKARIFVLNGLQPGNETSCAAMAITPVLNSLEQIA
QWSAHARELGKTLTAAVQIDTGMCRLGLSPEELEILSAKQQLLDGIEIAFVMSHLACADE
PDHVSNAAQLAVMRKAATAFPETPVCFSNSGGIFLGNDYHNALLRPGIALYGGAPSAAGP
NPMKPVVRLDVAVIQTRTVPAGSLVGYGGSFTASVPTRLATIAAGYADGLPRSLSNRGAA
WYNGVRLPIAGRVSMDSIILDISALPEGTLTQGSLVQMIGPDQTLEDIAEDAGTIAYEIL
TGLGRRYRRSYIQPGMSPATASTSVNHK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcagatcagccgccagcaggccgccggtggtgcaagcggccatctaaccatc
gatctgggcgcattgcgggataattacctgactcttgccggtatggcccccgcatcgcaa
acggccgccgtcgtgaaggccgatgcctatggtctcggcgcggatgtcgtctcacagacc
ctgttcgaggcgggttgccgcaatttcttcgtcgcccatatcgatgaggcgctggcactc
aggctccggctttcggcaaaggcgcggattttcgtcctcaatggtctgcagcccggcaac
gaaacctcctgcgccgccatggccatcaccccggttctgaactcgctggaacagatcgcg
caatggtcagctcatgccagagagctcggcaagacgctcaccgccgccgtccagatcgat
accggcatgtgccgccttgggctctcccccgaagagcttgaaatcctctccgccaagcag
cagttgctcgatggaattgagatcgccttcgtcatgagccatctcgcctgtgccgacgag
ccggatcatgtttccaatgccgcgcagctcgccgtgatgcgcaaggccgccaccgccttt
cccgagacgccggtctgtttttccaattcgggcggtatttttctcggcaacgactatcat
aacgctctactgcgccccggcatcgcgctttatggcggtgcgccttccgctgccggcccc
aacccgatgaagccggtcgttcgtctcgatgtcgccgtcattcagacccgcaccgttccc
gccggctcgctggttggttacggcggctcttttacggcgagcgttccgacgcggcttgcg
acaatcgctgccggctatgccgatggcctgccgcgttcgctcagcaatcgcggcgcggcg
tggtacaatggcgtgcgtctgccgattgccgggcgcgtttcgatggacagcatcattctc
gacatatccgccctgcccgagggaacattgacgcagggcagcctcgtgcagatgatcggg
cctgatcagacactggaagacatcgccgaggatgcgggcacgattgcctatgaaatcctg
accggcctcggccgccgttaccgccgcagctacattcaaccgggcatgagcccggcaacc
gcttcaacatcagtcaatcacaagtga

DBGET integrated database retrieval system